Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1462
Gene name
LocationContig_14:46164..47169
Strand-
Gene length (bp)1005
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 6.8E-14 125 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 2 284 2.0E-38
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 2 284 2.0E-38
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 274 7.0E-24
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 6 274 5.0E-22
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 126 287 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 2 284 2.0E-38
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 2 284 2.0E-38
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 6 274 7.0E-24
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 6 274 5.0E-22
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 126 287 2.0E-16
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 126 287 2.0E-15
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 109 270 6.0E-13
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 126 263 2.0E-12
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 110 273 6.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 66 273 7.0E-11
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 126 286 3.0E-08
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 126 263 7.0E-08
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 122 285 2.0E-07
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 126 262 2.0E-07
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 2 274 3.0E-07
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 126 263 1.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 155 277 1.0E-06
sp|D5AP78|CRTF_RHOCB Demethylspheroidene O-methyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtF PE=1 SV=1 112 225 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1462
MGYLIETGEDEYRLTNYTKAMSIPAIGNSYLAMLSCGSSGSIRFHEFSRKRGWVNPTDAKDTALMYAYGTNMDVF
KWQQFLGYGTHFNDHMAGYDLGRLPWMDPRFYPVKERLIDGADTDPEAPFLVDIAGNVGHDLARFHMFHPSFPGR
LILEDLPNVISTIQDLDPAIIRIEYDFHTEQPVKGARAYYMHNTLHDWPDEVCHGILAQIKAAMKPGYSRLLINE
YVIPETGAYWEATALDMVMLTLMSACERTRTGWYNLVETRAGLRIVKIWCGGKNSQSLIECELPEDEK*
Coding >OphauB2|1462
ATGGGGTACCTCATCGAGACTGGCGAGGACGAGTACAGGTTAACAAACTACACCAAGGCGATGAGCATCCCTGCT
ATCGGGAATAGCTACCTTGCCATGCTCTCGTGCGGAAGCTCTGGCTCTATACGCTTTCACGAATTCTCCCGAAAG
CGAGGATGGGTAAACCCAACAGATGCCAAAGATACGGCATTAATGTACGCCTATGGAACGAATATGGATGTGTTT
AAATGGCAGCAATTTCTAGGCTATGGTACACACTTTAATGATCACATGGCCGGCTACGACCTGGGCCGCTTGCCC
TGGATGGATCCTAGATTTTATCCGGTAAAGGAGAGGCTGATTGACGGCGCCGATACCGATCCAGAGGCTCCATTT
CTTGTTGATATTGCCGGCAACGTGGGCCATGATTTGGCGCGATTTCACATGTTTCATCCTAGCTTCCCAGGCAGG
TTGATTCTCGAGGATTTACCCAATGTTATTAGCACAATCCAGGACTTGGACCCGGCGATTATCCGTATAGAGTAC
GACTTTCATACAGAACAGCCCGTCAAAGGCGCCCGAGCCTATTACATGCATAATACTTTACACGACTGGCCAGAT
GAAGTGTGCCATGGCATCCTGGCGCAAATCAAGGCTGCAATGAAGCCTGGATACAGCAGGCTATTAATTAACGAG
TACGTGATACCAGAGACTGGCGCCTACTGGGAAGCGACAGCACTTGACATGGTCATGCTGACGCTCATGTCTGCT
TGCGAACGCACCCGCACTGGTTGGTATAACCTTGTCGAGACAAGGGCCGGCCTTAGGATCGTCAAGATTTGGTGC
GGTGGAAAGAACTCGCAGAGTTTAATCGAGTGTGAGCTCCCCGAGGATGAGAAATAA
Transcript >OphauB2|1462
ATGGGGTACCTCATCGAGACTGGCGAGGACGAGTACAGGTTAACAAACTACACCAAGGCGATGAGCATCCCTGCT
ATCGGGAATAGCTACCTTGCCATGCTCTCGTGCGGAAGCTCTGGCTCTATACGCTTTCACGAATTCTCCCGAAAG
CGAGGATGGGTAAACCCAACAGATGCCAAAGATACGGCATTAATGTACGCCTATGGAACGAATATGGATGTGTTT
AAATGGCAGCAATTTCTAGGCTATGGTACACACTTTAATGATCACATGGCCGGCTACGACCTGGGCCGCTTGCCC
TGGATGGATCCTAGATTTTATCCGGTAAAGGAGAGGCTGATTGACGGCGCCGATACCGATCCAGAGGCTCCATTT
CTTGTTGATATTGCCGGCAACGTGGGCCATGATTTGGCGCGATTTCACATGTTTCATCCTAGCTTCCCAGGCAGG
TTGATTCTCGAGGATTTACCCAATGTTATTAGCACAATCCAGGACTTGGACCCGGCGATTATCCGTATAGAGTAC
GACTTTCATACAGAACAGCCCGTCAAAGGCGCCCGAGCCTATTACATGCATAATACTTTACACGACTGGCCAGAT
GAAGTGTGCCATGGCATCCTGGCGCAAATCAAGGCTGCAATGAAGCCTGGATACAGCAGGCTATTAATTAACGAG
TACGTGATACCAGAGACTGGCGCCTACTGGGAAGCGACAGCACTTGACATGGTCATGCTGACGCTCATGTCTGCT
TGCGAACGCACCCGCACTGGTTGGTATAACCTTGTCGAGACAAGGGCCGGCCTTAGGATCGTCAAGATTTGGTGC
GGTGGAAAGAACTCGCAGAGTTTAATCGAGTGTGAGCTCCCCGAGGATGAGAAATAA
Gene >OphauB2|1462
ATGGGGTACCTCATCGAGACTGGCGAGGACGAGTACAGGTTAACAAACTACACCAAGGCGATGAGCATCCCTGCT
ATCGGGAATAGCTACCTTGCCATGTAAGCTCGCGCTCTCAGCAAGTCGGCCCTTGAAATAGCTGCTCAGATACAT
CCATAGGCTCTCGTGCGGAAGCTCTGGCTCTATACGCTTTCACGAATTCTCCCGAAAGCGAGGATGGGTAAACCC
AACAGATGCCAAAGATACGGCATTAATGTACGCCTATGGAACGAATATGGATGTGTTTAAATGGCAGCAATTTCT
AGGCTATGGTACACACTTTAATGATCACATGGCCGGCTACGACCTGGGCCGCTTGCCCTGGATGGATCCTAGATT
TTATCCGGTAAAGGAGAGGCTGATTGACGGCGCCGATACCGATCCAGAGGCTCCATTTCTTGTTGATATTGCCGG
CAACGTGGGCCATGATTTGGCGCGATTTCACATGTTTCATCCTAGCTTCCCAGGCAGGTTGATTCTCGAGGATTT
ACCCAATGTTATTAGCACAATCCAGGACTTGGACCCGGCGATTATCCGTATAGAGTACGACTTTCATACAGAACA
GCCCGTCAAAGGTAAGGTCCTTATAATGTAAAAACATTTTGCTTTGTGTGGCAGACACTTGTACTCACATTCTCA
GGCGCCCGAGCCTATTACATGCATAATACTTTACACGACTGGCCAGATGAAGTGTGCCATGGCATCCTGGCGCAA
ATCAAGGCTGCAATGAAGCCTGGATACAGCAGGCTATTAATTAACGAGTACGTGATACCAGAGACTGGCGCCTAC
TGGGAAGCGACAGCACTTGACATGGTCATGCTGACGCTCATGTCTGCTTGCGAACGCACCCGCACTGGTTGGTAT
AACCTTGTCGAGACAAGGGCCGGCCTTAGGATCGTCAAGATTTGGTGCGGTGGAAAGAACTCGCAGAGTTTAATC
GAGTGTGAGCTCCCCGAGGATGAGAAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail