Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1461
Gene name
LocationContig_14:44980..45915
Strand+
Gene length (bp)935
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06041 DUF924 Bacterial protein of unknown function (DUF924) 5.5E-50 18 250

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 8 (None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5818
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2678
Ophiocordyceps australis 1348a (Ghana) OphauG2|3957
Ophiocordyceps australis map64 (Brazil) OphauB2|1461 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4004
Ophiocordyceps camponoti-rufipedis Ophun1|7147

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1461
MAHGDTKFQPSLVQLREVHDFWYEQLTRPEDFVLPEKKHNEHWFFGNEAFDQMCVKSGITSGNDILEAVQLDDPL
DWVSLIILLDQIPRNCYRGDSAAIAFSFFDPMARDVALAAAKRGLPEANPQIRWQLAYRKWFYLPFVHAEDMEAH
VVATQGFEMMRKDVYDLTEETDGEEELEAPQGHERPDYRARARKAIQANVARSRLTLDTWADAEKRHVDIIKRFG
RFPHRNDALGRTSTMEEREYLENGGETFARPKSTLGVGGCGAAQVHN*
Coding >OphauB2|1461
ATGGCCCACGGTGACACCAAGTTTCAACCAAGTCTCGTGCAGCTGCGCGAAGTTCACGATTTCTGGTATGAGCAG
CTCACTCGCCCAGAGGACTTTGTCCTTCCCGAAAAGAAGCACAACGAACACTGGTTCTTTGGCAATGAGGCGTTT
GACCAGATGTGTGTAAAGAGCGGCATTACGAGTGGAAATGATATCCTCGAAGCGGTTCAGCTAGACGACCCTCTC
GACTGGGTCAGCCTCATTATCTTATTGGACCAAATCCCGCGCAACTGCTATCGCGGTGACAGTGCGGCCATAGCC
TTTAGTTTCTTTGACCCCATGGCGCGAGACGTTGCTCTCGCCGCCGCAAAACGAGGCCTCCCCGAGGCGAACCCG
CAAATCAGGTGGCAGCTTGCCTATCGGAAATGGTTCTATCTTCCCTTTGTACATGCAGAGGACATGGAGGCGCAT
GTTGTGGCAACGCAGGGCTTTGAGATGATGCGCAAGGACGTGTATGACTTGACCGAGGAAACAGACGGCGAAGAA
GAATTGGAGGCGCCGCAGGGGCATGAGCGGCCGGATTATCGGGCCAGGGCTCGTAAAGCGATTCAGGCCAACGTG
GCGCGCAGTCGTTTGACTCTGGACACGTGGGCTGATGCTGAGAAGAGACATGTGGATATTATAAAGCGGTTTGGG
CGATTTCCGCATCGCAACGACGCCCTGGGAAGGACTTCTACTATGGAAGAGAGGGAGTACCTTGAAAATGGAGGG
GAGACGTTTGCGCGACCAAAGTCAACTTTGGGTGTCGGGGGTTGTGGCGCGGCACAGGTGCATAACTAG
Transcript >OphauB2|1461
ATGGCCCACGGTGACACCAAGTTTCAACCAAGTCTCGTGCAGCTGCGCGAAGTTCACGATTTCTGGTATGAGCAG
CTCACTCGCCCAGAGGACTTTGTCCTTCCCGAAAAGAAGCACAACGAACACTGGTTCTTTGGCAATGAGGCGTTT
GACCAGATGTGTGTAAAGAGCGGCATTACGAGTGGAAATGATATCCTCGAAGCGGTTCAGCTAGACGACCCTCTC
GACTGGGTCAGCCTCATTATCTTATTGGACCAAATCCCGCGCAACTGCTATCGCGGTGACAGTGCGGCCATAGCC
TTTAGTTTCTTTGACCCCATGGCGCGAGACGTTGCTCTCGCCGCCGCAAAACGAGGCCTCCCCGAGGCGAACCCG
CAAATCAGGTGGCAGCTTGCCTATCGGAAATGGTTCTATCTTCCCTTTGTACATGCAGAGGACATGGAGGCGCAT
GTTGTGGCAACGCAGGGCTTTGAGATGATGCGCAAGGACGTGTATGACTTGACCGAGGAAACAGACGGCGAAGAA
GAATTGGAGGCGCCGCAGGGGCATGAGCGGCCGGATTATCGGGCCAGGGCTCGTAAAGCGATTCAGGCCAACGTG
GCGCGCAGTCGTTTGACTCTGGACACGTGGGCTGATGCTGAGAAGAGACATGTGGATATTATAAAGCGGTTTGGG
CGATTTCCGCATCGCAACGACGCCCTGGGAAGGACTTCTACTATGGAAGAGAGGGAGTACCTTGAAAATGGAGGG
GAGACGTTTGCGCGACCAAAGTCAACTTTGGGTGTCGGGGGTTGTGGCGCGGCACAGGTGCATAACTAG
Gene >OphauB2|1461
ATGGCCCACGGTGACACCAAGTTTCAACCAAGTCTCGTGCAGCTGCGCGAAGTTCACGATTTCTGGTATGAGCAG
CTCACTCGCCCAGAGGACTTTGTCCTTCCCGAAAAGAAGCACAACGAACACTGGTTCTTTGGCAATGAGGCGTTT
GACCAGATGTGTGTGTACGGCGCCCTTTTTTTCAAATTTCTGTCATGCCGTAATCCTTATAGCCCAGTTAATGTT
GACAAATTTGCACGGGGCGAAGAGAGCGATTCGGCACTCTGCTAGAGAGCATTAGAAAGAGCGGCATTACGAGTG
GAAATGATATCCTCGAAGCGGTTCAGCTAGACGACCCTCTCGACTGGGTCAGCCTCATTATCTTATTGGACCAAA
TCCCGCGCAACTGCTATCGCGGTGACAGTGCGGCCATAGCCTTTAGTTTCTTTGACCCCATGGCGCGAGACGTTG
CTCTCGCCGCCGCAAAACGAGGCCTCCCCGAGGCGAACCCGCAAATCAGGTGGCAGCTTGCCTATCGGAAATGGT
TCTATCTTCCCTTTGTACATGCAGAGGACATGGAGGCGCATGTTGTGGCAACGCAGGGCTTTGAGATGATGCGCA
AGGACGTGTATGACTTGACCGAGGAAACAGACGGCGAAGAAGAATTGGAGGCGCCGCAGGGGCATGAGCGGCCGG
ATTATCGGGCCAGGGCTCGTAAAGCGATTCAGGCCAACGTGGCGCGCAGTCGTTTGACTCTGGACACGTGGGCTG
ATGCTGAGAAGAGACATGTGGATATTATAAAGCGGTTTGGGCGATTTCCGCATCGCAACGACGCCCTGGGAAGGA
CTTCTACTATGGAAGAGAGGGAGTACCTTGAAAATGGAGGGGAGACGTTTGCGCGACCAAAGTCAACTTTGGGTG
TCGGGGGTTGTGGCGCGGCACAGGTGCATAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail