Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1458
Gene name
LocationContig_14:34455..39792
Strand+
Gene length (bp)5337
Transcript length (bp)5016
Coding sequence length (bp)5016
Protein length (aa) 1672

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.9E-09 870 934
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-12 875 970
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-09 1149 1229
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.3E-08 1319 1393
PF13857 Ank_5 Ankyrin repeats (many copies) 2.9E-07 1324 1378
PF00023 Ank Ankyrin repeat 3.6E-05 907 935
PF00023 Ank Ankyrin repeat 2.6E-02 1337 1366
PF13606 Ank_3 Ankyrin repeat 5.3E-04 907 933

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 872 1398 7.0E-27
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 872 1398 7.0E-26
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 803 1367 8.0E-26
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 878 1515 2.0E-25
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 878 1365 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 872 1398 7.0E-27
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 872 1398 7.0E-26
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 803 1367 8.0E-26
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 878 1515 2.0E-25
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 878 1365 5.0E-25
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 872 1375 2.0E-24
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 872 1396 6.0E-24
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 872 1375 2.0E-23
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 872 1396 2.0E-23
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 872 1375 5.0E-23
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 872 1375 7.0E-23
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 872 1396 1.0E-22
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 872 1397 3.0E-22
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 866 1365 4.0E-22
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 872 1393 2.0E-21
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 872 1403 2.0E-21
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 873 1364 2.0E-21
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 872 1403 3.0E-21
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 872 1375 4.0E-21
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 872 1393 1.0E-20
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 872 1397 1.0E-20
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 868 1399 2.0E-20
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 870 1292 2.0E-19
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 884 1397 5.0E-19
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 872 1393 6.0E-19
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 899 1393 6.0E-19
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 1184 1387 7.0E-19
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 873 1291 1.0E-18
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 873 1291 1.0E-18
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 1134 1397 2.0E-18
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 1134 1393 7.0E-18
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 873 1396 8.0E-18
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1139 1391 1.0E-17
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 1184 1393 2.0E-17
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 1184 1390 3.0E-17
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 926 1391 5.0E-17
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1140 1390 6.0E-17
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 869 1323 9.0E-17
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 869 1265 9.0E-17
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 869 1324 1.0E-16
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 1185 1397 1.0E-16
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1151 1397 2.0E-16
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1045 1397 2.0E-16
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 926 1391 2.0E-16
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 882 1390 2.0E-16
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 875 1360 2.0E-16
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 868 1398 2.0E-16
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 882 1390 3.0E-16
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 869 1301 4.0E-16
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 899 1362 6.0E-16
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 910 1391 9.0E-16
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 868 1364 9.0E-16
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1175 1399 1.0E-15
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1023 1397 1.0E-15
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 1135 1397 1.0E-15
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1175 1405 2.0E-15
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 895 1390 2.0E-15
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 867 1399 2.0E-15
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 872 1424 3.0E-15
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 868 1364 4.0E-15
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 872 1424 5.0E-15
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1154 1416 6.0E-15
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 870 1416 6.0E-15
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 926 1391 7.0E-15
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 1135 1397 7.0E-15
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1175 1435 1.0E-14
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1175 1399 1.0E-14
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 868 1364 1.0E-14
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 842 1391 1.0E-14
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 1205 1391 1.0E-14
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 872 1393 2.0E-14
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1175 1435 2.0E-14
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 899 1362 2.0E-14
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 1182 1397 2.0E-14
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 868 1391 3.0E-14
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 1182 1397 4.0E-14
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 1057 1393 5.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 1162 1402 7.0E-14
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 870 1416 7.0E-14
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 869 1308 8.0E-14
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 875 1391 1.0E-13
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 1095 1402 2.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 869 1308 2.0E-13
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 1121 1402 2.0E-13
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 1057 1393 2.0E-13
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 922 1345 2.0E-13
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 867 1424 2.0E-13
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1149 1397 3.0E-13
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 851 1385 3.0E-13
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1149 1397 4.0E-13
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 867 1424 4.0E-13
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 873 1218 5.0E-13
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1175 1399 5.0E-13
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 872 1063 5.0E-13
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 1058 1391 7.0E-13
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 872 1063 8.0E-13
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 1164 1421 8.0E-13
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 1175 1397 9.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1142 1392 1.0E-12
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 922 1345 1.0E-12
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 1118 1392 2.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 869 1301 2.0E-12
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 1174 1364 2.0E-12
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 1150 1384 2.0E-12
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 1118 1392 3.0E-12
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 920 1416 3.0E-12
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 1080 1380 4.0E-12
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 1208 1392 6.0E-12
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 873 1065 7.0E-12
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1141 1387 7.0E-12
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 872 1063 8.0E-12
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 1174 1364 8.0E-12
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 943 1434 9.0E-12
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 1164 1421 9.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 867 1337 9.0E-12
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 1165 1421 1.0E-11
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 1169 1421 1.0E-11
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 1169 1421 1.0E-11
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 1174 1364 1.0E-11
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 875 1375 1.0E-11
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 1163 1408 2.0E-11
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 1165 1390 2.0E-11
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 1178 1435 2.0E-11
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 1140 1391 2.0E-11
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 1165 1385 2.0E-11
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 1165 1341 2.0E-11
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 1165 1421 2.0E-11
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 1208 1382 2.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 868 1310 2.0E-11
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1174 1364 2.0E-11
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 1165 1390 3.0E-11
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 872 1063 3.0E-11
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 1204 1379 3.0E-11
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 1178 1435 3.0E-11
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 1204 1379 3.0E-11
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 1208 1391 3.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 871 1325 4.0E-11
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 1164 1390 4.0E-11
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 1204 1379 4.0E-11
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 1204 1370 4.0E-11
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 1184 1393 4.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 926 1362 4.0E-11
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 1141 1396 5.0E-11
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 887 1346 5.0E-11
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 1159 1375 5.0E-11
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 868 1393 5.0E-11
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 1175 1409 5.0E-11
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 868 1241 5.0E-11
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1175 1391 6.0E-11
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 1140 1391 6.0E-11
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 851 1385 6.0E-11
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 1174 1390 7.0E-11
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 868 1063 7.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 873 1391 8.0E-11
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 868 1063 8.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 1172 1402 8.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 1172 1402 8.0E-11
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 896 1364 9.0E-11
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 858 1392 1.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 887 1346 1.0E-10
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 1140 1391 1.0E-10
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 1183 1390 1.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 1122 1363 1.0E-10
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 1165 1390 1.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 1175 1400 1.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 1175 1400 1.0E-10
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 867 1053 1.0E-10
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 867 1053 2.0E-10
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 1205 1379 2.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 873 1391 2.0E-10
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 1169 1390 2.0E-10
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 865 967 2.0E-10
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 1172 1393 2.0E-10
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 1185 1397 2.0E-10
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 1165 1390 2.0E-10
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 868 1063 2.0E-10
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 1190 1390 2.0E-10
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 1175 1375 2.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 868 1257 2.0E-10
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 875 1392 3.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 868 1372 3.0E-10
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 1167 1347 3.0E-10
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 868 1063 3.0E-10
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 1165 1421 3.0E-10
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 1186 1390 3.0E-10
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 1186 1390 3.0E-10
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 1205 1380 3.0E-10
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 868 1257 3.0E-10
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 1165 1421 4.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 869 1395 6.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 871 1325 6.0E-10
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 868 1063 6.0E-10
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 1151 1412 6.0E-10
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 1186 1390 6.0E-10
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 1168 1421 6.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 1175 1400 6.0E-10
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 1165 1390 6.0E-10
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1174 1391 6.0E-10
sp|Q5UPG6|YL092_MIMIV Putative ankyrin repeat protein L92 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L92 PE=3 SV=1 1207 1373 7.0E-10
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 1165 1390 7.0E-10
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 1186 1390 7.0E-10
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 1186 1390 8.0E-10
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 1186 1390 8.0E-10
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 1175 1395 8.0E-10
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 1178 1364 9.0E-10
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 868 1257 9.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1174 1391 9.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 1204 1391 1.0E-09
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 1174 1389 1.0E-09
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 1174 1391 1.0E-09
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 1150 1364 1.0E-09
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 1140 1358 1.0E-09
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 1186 1390 1.0E-09
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 1189 1401 1.0E-09
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1204 1407 1.0E-09
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 1173 1392 2.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 868 1372 2.0E-09
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 1174 1389 2.0E-09
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 1174 1389 2.0E-09
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 1175 1374 2.0E-09
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 1179 1363 2.0E-09
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 1178 1390 2.0E-09
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 1179 1363 2.0E-09
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 868 1063 2.0E-09
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 1186 1396 2.0E-09
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 854 1237 2.0E-09
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 854 1245 2.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 868 1402 2.0E-09
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 1174 1402 2.0E-09
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 1190 1390 2.0E-09
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 1165 1341 2.0E-09
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 1274 1391 2.0E-09
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 1081 1381 2.0E-09
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 1205 1362 2.0E-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 873 1063 3.0E-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 873 1063 3.0E-09
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 1167 1347 3.0E-09
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 1201 1392 3.0E-09
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 1140 1341 3.0E-09
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 872 1345 3.0E-09
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 1137 1381 3.0E-09
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 1174 1402 3.0E-09
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 1190 1390 3.0E-09
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 1190 1390 3.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 873 1091 4.0E-09
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 1171 1404 4.0E-09
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 875 1392 4.0E-09
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 1182 1383 4.0E-09
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 1175 1389 4.0E-09
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 873 1080 4.0E-09
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 1174 1402 4.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 885 1397 5.0E-09
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 1205 1418 5.0E-09
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 1174 1402 5.0E-09
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 1175 1374 5.0E-09
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 1205 1400 6.0E-09
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 868 1402 6.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 869 1395 7.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 1173 1404 7.0E-09
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 877 1065 7.0E-09
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1175 1397 8.0E-09
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 867 1053 8.0E-09
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 1205 1391 9.0E-09
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 1179 1363 9.0E-09
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 1217 1402 9.0E-09
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 1140 1378 9.0E-09
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 1151 1346 9.0E-09
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 1213 1375 9.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 868 1103 1.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 1167 1347 1.0E-08
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 1204 1378 1.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 1173 1404 1.0E-08
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 1159 1393 1.0E-08
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1175 1397 1.0E-08
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 1190 1378 1.0E-08
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 1205 1391 1.0E-08
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 1178 1390 1.0E-08
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 1205 1362 1.0E-08
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 1184 1387 1.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 920 1392 1.0E-08
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 868 1083 2.0E-08
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 1178 1364 2.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1141 1376 2.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 1205 1362 2.0E-08
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 1205 1362 2.0E-08
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 1205 1362 2.0E-08
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 1190 1378 2.0E-08
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 1175 1394 2.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 1175 1381 2.0E-08
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 867 1061 2.0E-08
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 1190 1378 2.0E-08
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 842 1063 2.0E-08
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 1178 1390 2.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 1152 1392 2.0E-08
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 1152 1411 2.0E-08
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 1175 1378 2.0E-08
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 868 1083 3.0E-08
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 1171 1370 3.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 868 1402 3.0E-08
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 867 1063 3.0E-08
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 1189 1364 3.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 865 971 3.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 1183 1399 3.0E-08
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 874 1381 3.0E-08
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 1204 1390 3.0E-08
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-08
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-08
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 1205 1358 3.0E-08
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-08
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 1172 1381 3.0E-08
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-08
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 1274 1391 3.0E-08
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-08
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 1171 1370 3.0E-08
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 1131 1391 4.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 869 1090 4.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 920 1392 4.0E-08
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 1205 1391 4.0E-08
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 1178 1390 4.0E-08
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 1205 1358 4.0E-08
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 1172 1381 4.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 1149 1391 5.0E-08
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 1171 1370 5.0E-08
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 1137 1381 5.0E-08
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 1151 1364 5.0E-08
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 899 1397 5.0E-08
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 1205 1358 5.0E-08
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 1181 1401 5.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 1186 1399 5.0E-08
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 1172 1381 6.0E-08
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 1205 1358 6.0E-08
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 1145 1375 6.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 888 1407 6.0E-08
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 870 1062 6.0E-08
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 1172 1381 6.0E-08
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 1205 1401 6.0E-08
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 1190 1397 6.0E-08
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 1152 1392 7.0E-08
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 1240 1391 7.0E-08
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 1178 1362 7.0E-08
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 973 1392 7.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 866 1292 7.0E-08
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 1174 1416 8.0E-08
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 1174 1342 8.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 1205 1391 9.0E-08
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 1178 1393 9.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 1175 1375 9.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 1204 1378 9.0E-08
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 1205 1391 1.0E-07
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 1186 1362 1.0E-07
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 1205 1358 1.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 1175 1397 1.0E-07
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 859 1198 1.0E-07
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 1208 1380 1.0E-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 1205 1391 1.0E-07
sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 1245 1393 1.0E-07
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 868 998 1.0E-07
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 1201 1406 1.0E-07
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 1163 1364 1.0E-07
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 1205 1362 1.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 1205 1398 1.0E-07
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 1175 1364 1.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 862 972 1.0E-07
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 1175 1392 1.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 860 972 1.0E-07
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 1184 1387 2.0E-07
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 1205 1391 2.0E-07
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 1168 1392 2.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 1190 1424 2.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 1265 1392 2.0E-07
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 873 1017 2.0E-07
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 1168 1392 2.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 1219 1392 2.0E-07
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 1182 1383 2.0E-07
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 1170 1362 2.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 1205 1398 2.0E-07
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 1145 1397 2.0E-07
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 1178 1393 2.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 1205 1398 2.0E-07
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 1265 1392 2.0E-07
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 1151 1310 2.0E-07
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 1151 1310 2.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 1204 1375 2.0E-07
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 862 966 2.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 909 1256 2.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1175 1392 2.0E-07
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 1140 1379 3.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 867 1034 3.0E-07
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 1205 1373 3.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 818 1021 3.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1175 1392 3.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 1205 1391 3.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 1186 1392 3.0E-07
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 1151 1310 3.0E-07
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 1190 1384 3.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 1204 1391 3.0E-07
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 1184 1387 3.0E-07
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 1204 1388 3.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 1205 1358 3.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 1186 1392 3.0E-07
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 1205 1374 3.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 867 1061 3.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1175 1392 3.0E-07
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 1205 1402 3.0E-07
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 1175 1392 3.0E-07
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 867 1062 3.0E-07
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 868 1332 3.0E-07
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 869 1067 4.0E-07
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 1200 1392 4.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 1196 1393 4.0E-07
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 1171 1370 4.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 1189 1364 5.0E-07
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 1205 1366 5.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 1140 1412 5.0E-07
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 1204 1392 5.0E-07
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 1184 1325 5.0E-07
sp|Q9WV74|ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 1202 1405 5.0E-07
sp|Q29Q26|AKR2B_ARATH Ankyrin repeat domain-containing protein 2B OS=Arabidopsis thaliana GN=AKR2B PE=1 SV=1 1298 1390 5.0E-07
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 1156 1403 5.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 1175 1362 5.0E-07
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 1173 1397 5.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 1233 1395 6.0E-07
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1141 1378 6.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 839 1021 6.0E-07
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 1213 1400 6.0E-07
sp|Q875S9|AKR1_LACK1 Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 1204 1387 6.0E-07
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 1200 1392 6.0E-07
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 1204 1388 6.0E-07
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 1181 1359 6.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 1205 1405 6.0E-07
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 1200 1392 6.0E-07
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 1169 1397 6.0E-07
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 1204 1390 6.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 1164 1397 6.0E-07
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 1204 1392 6.0E-07
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 873 1091 6.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 1205 1398 7.0E-07
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 871 968 7.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 1173 1391 7.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1175 1392 7.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 860 1198 7.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 849 1067 8.0E-07
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 1204 1392 8.0E-07
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 1156 1403 8.0E-07
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 1164 1397 8.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 1173 1387 8.0E-07
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 853 961 8.0E-07
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 853 961 8.0E-07
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 1250 1405 9.0E-07
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 853 961 9.0E-07
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 853 961 9.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 1205 1394 9.0E-07
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 853 961 9.0E-07
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 1175 1364 1.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 1151 1292 1.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 869 1067 1.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 872 1198 1.0E-06
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 1273 1397 1.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 1273 1397 1.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 1170 1364 1.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 1091 1364 1.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 1196 1391 1.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 1250 1405 1.0E-06
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 853 961 1.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 1205 1394 1.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 1162 1390 1.0E-06
sp|Q9J5I9|V012_FOWPN Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 1231 1425 1.0E-06
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 1205 1398 1.0E-06
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 1204 1392 1.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 1205 1405 1.0E-06
sp|Q5UQC4|YR229_MIMIV Putative ankyrin repeat protein R229 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R229 PE=3 SV=1 1175 1264 1.0E-06
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 1166 1391 1.0E-06
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 1172 1381 1.0E-06
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 873 989 1.0E-06
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 1152 1392 1.0E-06
sp|Q9Y576|ASB1_HUMAN Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 1274 1433 1.0E-06
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 1220 1363 1.0E-06
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 1155 1387 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1174 1397 1.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 1237 1462 1.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 1141 1375 1.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 1141 1375 1.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 845 1091 1.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 1205 1391 2.0E-06
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 1273 1397 2.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 1170 1364 2.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 1204 1411 2.0E-06
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 1201 1392 2.0E-06
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 1078 1397 2.0E-06
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 1152 1375 2.0E-06
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 1186 1397 2.0E-06
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 1220 1360 2.0E-06
sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 1220 1363 2.0E-06
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 872 1101 2.0E-06
sp|Q4R739|ANR53_MACFA Ankyrin repeat domain-containing protein 53 OS=Macaca fascicularis GN=ANKRD53 PE=2 SV=1 865 969 2.0E-06
sp|Q4UKX2|Y950_RICFE Putative ankyrin repeat protein RF_0950 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0950 PE=3 SV=1 1190 1360 2.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 867 1062 2.0E-06
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 1152 1375 2.0E-06
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 1186 1392 2.0E-06
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 1140 1393 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 860 972 2.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 1173 1378 2.0E-06
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 1151 1300 2.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 1173 1378 2.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 897 970 2.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 1318 1392 2.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 1175 1392 2.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 897 970 2.0E-06
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 1205 1398 2.0E-06
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 1201 1397 2.0E-06
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 867 1109 2.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 1169 1361 3.0E-06
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 1184 1393 3.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 1170 1364 3.0E-06
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 1159 1391 3.0E-06
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 1273 1397 3.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 1240 1405 3.0E-06
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 1273 1397 3.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 866 1063 3.0E-06
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 868 948 3.0E-06
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 899 1002 3.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 1273 1397 3.0E-06
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 1170 1352 3.0E-06
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 1150 1391 3.0E-06
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 944 1357 3.0E-06
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 868 969 3.0E-06
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 839 969 3.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 1185 1364 3.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 1151 1342 3.0E-06
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 1151 1358 3.0E-06
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 1186 1392 3.0E-06
sp|Q9SAR5|AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana GN=AKR2A PE=1 SV=2 868 963 3.0E-06
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 1186 1392 3.0E-06
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 1240 1391 3.0E-06
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 1275 1431 3.0E-06
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 871 1003 3.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 868 1394 3.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 1237 1436 3.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 867 1003 3.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 1237 1405 3.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 1169 1361 3.0E-06
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 867 1065 3.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 1318 1392 3.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 1318 1392 3.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 1175 1387 3.0E-06
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 1273 1397 3.0E-06
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 1141 1375 4.0E-06
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 1141 1375 4.0E-06
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 1202 1392 4.0E-06
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 1202 1392 4.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 1140 1363 4.0E-06
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 1205 1308 4.0E-06
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 1185 1382 4.0E-06
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 875 1003 4.0E-06
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 871 1003 4.0E-06
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 871 1003 4.0E-06
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 1318 1466 5.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 1141 1380 5.0E-06
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 1151 1357 5.0E-06
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 1159 1391 5.0E-06
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 1193 1374 5.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 1205 1384 5.0E-06
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 1186 1392 5.0E-06
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 1186 1392 5.0E-06
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 1174 1341 5.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 866 1063 5.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 1174 1310 6.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 1175 1434 6.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 873 972 6.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 868 948 6.0E-06
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 1201 1392 6.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 866 1070 6.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 1318 1436 6.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 1145 1397 7.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 1194 1405 7.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 866 1063 7.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 868 948 7.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 1172 1394 7.0E-06
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 1205 1376 7.0E-06
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 853 987 7.0E-06
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 871 1003 7.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 1318 1392 8.0E-06
sp|Q9SAR5|AKR2A_ARATH Ankyrin repeat domain-containing protein 2A OS=Arabidopsis thaliana GN=AKR2A PE=1 SV=2 1298 1390 8.0E-06
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 868 948 8.0E-06
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 1195 1393 8.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 866 1063 8.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 1318 1392 8.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 1318 1392 8.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 875 1031 9.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 1178 1341 9.0E-06
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 1238 1420 9.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 1174 1309 9.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 1185 1364 9.0E-06
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 1205 1374 1.0E-05
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 1141 1404 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1458
MSQPAKPSRRGTMEWPQGASPYDAMQQGVTVLHPSGKEAQDKTKIDVVLVPGLGANPEKSWMWPKGDFSWPTDAK
GLVGDNPEARILLHMYESAWIGQRKVNQSIVNAAKSLLHGLDHFSPLKGKTRRPVVFIGHSMGGLVIAKAVTLMK
KNSERWPNMLEAVAGAAFFGTPFRGADSASWAGIFAKFSNSEFGTDLKSQLLSLMNPQSGEIHELRNDFNLLATT
LQPPIKLCCFWEQHPTNPANFARSADPSGLISHLVPRGVITEIVSEQSATLDGATSIGLACDHRGLVKFSGPKDK
NWMMGVRAPLKEIISEGPAVVRKRLMAIRDIDHQLIGKITKALQTGPVDQKRNSLSKIFKPSSWIPKEQEFVEWL
DRAWIRGPQGEDKNQDQDPVGLDPLGSYIWIRGPQGRGKTGATLAAIAEVEDMQLKAQLRNPDDQVFKAYFFCSE
GGEYCTAEDLLKSIITQLIDQERMLAAYAKQFVSDKDKDKDSKDQHSKPAAQATVENLWRALHDMLWEELSGPRT
RVYFLLNNLHALPRPSESTNKLLKYINEALTPDVKGNTQWPRSTCWFITSREGVGCIDNALDVRGKRLINLMDPK
YEDQVQRELRKYAKTGLDSLATKKKYSKALRYLTGGLIGGRASSTQWIDVMYMLLEELPNSEDDAQVRSELEAMP
QELKSLLTHSWQGFFRSNAGAMQNMKEMLRTLVLTYDDPTEAELAVLAGFASSPKRKGELRALVDKCKPLLRTRV
EHLMEHSKELLGVVPEETASQNERAATNDASESGVPSEGEHGEEEEEYVVDTESDDLQMDNAKTSYSVKYWLKHA
SEATLEVAQQLSQEQYFWKPDSPVRCRWLDEYSRTENTFIYLDIKSMTGLHIACSIGYQELVEALIQEGYKDQIN
VHDSLENTPLHLAAFFDQGEIIDVLLRHGANVNDQGSTGVEETPLHMAAHQGRLDVISKLTREKADPNATAVEIG
PVINAAICSGVADAVYRLVECGARFDVIPGPSDDWCGPVELAALHWNLPMIESLIEKSGGKIPAEQYSRALIQAA
YGGRNDVLKRLLEFDHSRQVFQNALEAAGEEENWEICKMILGLEKCKGLELDCEELFFQAASCIESPVSVLEEIW
GYTGGFISETILAKSLYDATDMEKEDTVKFLLETCHASPEATGEEFGNALTAAAYDGVEKIVLMLLDAGAEVNSP
NGWALQEAAAQGNLNIVKILLDRGAEVNAEINNGGFPPGTALQGACEAAEPEIVDLLLARNANPNLGLGSESPPV
VAAALRGADDILEKLVKARAKVDVVDGDGETTLLNRATAILSVESLQLLLDAGANVNFADENGNTPLIVAAGINE
ADAVQLFLDYGADILYVNEDGKNAMQEAFENESEESLKILIDRVSSIFSLLKTERDTGSAEIASFMRNAFGPSKN
RSVEMGCEEPKQQPEDNVVKETPPLNYEGCERELQGSKRPMAVPNFYQTCLDQPPSPMREANETLYQQEQQIATY
EASQQVKKAEYMHQDAGQLQHASPSQPTPTPSNESSTSNRIPRRPVGDQGSTGLSPSQLHQTTHSTPNPSQQEPA
EPQWHAPNNSPGQPSAQAWLGQEEYWHAPGTRFDGGARVDSLEQHHEPGSKQKWQALKPFNRLALNDMMDKTLER
TGLDKTMDKAVEKGKSFLSRR*
Coding >OphauB2|1458
ATGTCACAACCGGCAAAGCCAAGTCGCAGGGGAACCATGGAGTGGCCTCAGGGCGCCAGCCCCTATGATGCTATG
CAACAGGGTGTCACGGTGCTGCATCCCAGTGGTAAGGAGGCACAAGACAAGACAAAGATTGATGTGGTGCTGGTT
CCCGGCCTGGGCGCCAATCCAGAAAAGAGCTGGATGTGGCCAAAGGGAGACTTTAGTTGGCCGACGGATGCAAAA
GGCCTCGTCGGCGACAATCCCGAGGCACGTATCCTGCTGCACATGTACGAGTCTGCGTGGATTGGCCAACGAAAG
GTCAACCAAAGCATCGTCAACGCGGCCAAATCACTGCTCCATGGCCTAGATCATTTTTCACCCCTCAAAGGAAAA
ACGAGACGACCAGTTGTATTTATCGGCCACAGCATGGGGGGCCTTGTAATTGCAAAGGCCGTGACGCTGATGAAG
AAGAACTCTGAGCGGTGGCCCAATATGCTCGAGGCGGTTGCCGGCGCCGCATTTTTCGGTACGCCCTTTCGAGGC
GCCGACTCGGCTAGTTGGGCAGGCATCTTTGCCAAGTTTAGTAACAGTGAATTCGGCACGGATTTAAAGTCTCAG
CTACTCAGCCTCATGAACCCTCAGTCCGGGGAGATTCACGAGCTGAGAAACGACTTTAACTTGCTGGCTACTACG
CTGCAACCCCCAATCAAGCTTTGTTGCTTCTGGGAACAACATCCAACAAACCCAGCCAATTTTGCACGTTCGGCC
GATCCCTCCGGTCTCATCAGCCACCTTGTGCCCCGGGGTGTCATCACCGAGATTGTCAGTGAGCAATCGGCGACT
CTGGATGGGGCAACGTCAATCGGTCTTGCGTGCGACCATCGCGGACTGGTCAAGTTTAGCGGACCCAAGGATAAG
AACTGGATGATGGGGGTGCGCGCTCCTCTCAAAGAGATAATTAGCGAGGGCCCTGCTGTTGTCAGGAAGCGGCTC
ATGGCTATTCGCGATATCGACCATCAGCTGATTGGCAAGATAACAAAAGCCCTCCAGACTGGCCCAGTTGATCAG
AAGCGCAACTCCCTCTCAAAGATTTTCAAGCCGTCCTCGTGGATCCCCAAAGAGCAGGAATTTGTCGAGTGGCTC
GACCGGGCTTGGATCCGTGGCCCCCAGGGCGAGGACAAGAATCAAGATCAGGACCCTGTAGGCTTGGATCCGCTA
GGCAGTTATATCTGGATTCGGGGACCGCAGGGTCGTGGCAAGACGGGCGCTACGCTGGCTGCCATTGCCGAGGTT
GAAGACATGCAACTGAAAGCACAGCTAAGAAACCCTGATGACCAAGTGTTCAAGGCATACTTCTTTTGCAGTGAA
GGGGGTGAATATTGCACGGCAGAGGACCTTTTAAAGTCTATCATTACTCAGCTCATTGACCAGGAAAGGATGCTG
GCCGCTTACGCCAAGCAGTTTGTCAGTGACAAAGACAAGGACAAGGATAGCAAGGACCAACATTCCAAGCCTGCT
GCCCAGGCGACAGTCGAGAATCTATGGCGAGCCTTGCACGATATGCTCTGGGAGGAGTTGTCTGGGCCCAGGACA
CGTGTCTATTTTTTACTCAACAACCTGCACGCCCTCCCACGGCCTTCTGAATCGACAAACAAGCTGCTAAAGTAC
ATCAACGAGGCACTCACTCCCGATGTCAAGGGCAACACCCAATGGCCTCGCTCTACATGCTGGTTCATCACCAGC
AGAGAAGGCGTGGGATGCATCGACAACGCATTGGATGTCAGGGGCAAGCGACTCATCAACCTCATGGACCCCAAG
TACGAAGACCAGGTGCAACGTGAGCTGCGCAAATACGCAAAGACTGGTCTTGATAGTCTTGCCACGAAAAAGAAA
TACAGCAAGGCGCTGCGATATCTTACTGGAGGCCTGATTGGAGGGCGGGCGAGCAGTACCCAGTGGATCGACGTC
ATGTACATGCTGCTAGAGGAGCTTCCGAATAGCGAGGACGATGCCCAAGTCCGCTCAGAGCTCGAGGCCATGCCG
CAGGAGCTCAAGTCTCTACTGACGCATTCATGGCAGGGCTTCTTCAGATCCAACGCCGGCGCCATGCAAAACATG
AAGGAGATGCTCCGTACCTTGGTCTTGACATATGACGACCCAACCGAGGCGGAGCTGGCGGTGCTGGCAGGCTTT
GCATCAAGCCCAAAACGAAAAGGCGAGCTGCGCGCCCTCGTCGACAAATGCAAGCCGTTGCTGCGTACTCGTGTC
GAGCACTTGATGGAGCACTCCAAGGAGCTTTTAGGTGTTGTTCCCGAGGAGACAGCAAGCCAAAATGAAAGGGCA
GCTACTAATGATGCTTCTGAGAGTGGTGTGCCGTCGGAAGGCGAGCATGGCGAAGAGGAGGAGGAGTATGTCGTC
GACACCGAGTCAGACGACTTGCAGATGGACAATGCTAAGACGAGCTACTCCGTCAAGTATTGGCTGAAACACGCA
AGCGAGGCAACCCTCGAGGTTGCGCAGCAACTCAGTCAGGAGCAATACTTTTGGAAACCAGACTCGCCTGTCCGA
TGCAGGTGGCTAGACGAGTACTCGAGGACCGAGAACACTTTTATCTACCTCGACATCAAATCCATGACGGGCCTT
CACATTGCGTGTTCGATAGGTTACCAGGAACTCGTCGAAGCGTTGATCCAAGAGGGCTACAAAGACCAGATTAAT
GTCCATGACAGCCTTGAAAATACACCATTACATTTGGCGGCCTTTTTTGATCAGGGCGAAATTATCGACGTGCTA
CTGCGCCACGGCGCCAATGTCAACGACCAGGGCAGCACGGGCGTCGAGGAAACTCCATTGCACATGGCTGCCCAT
CAAGGCCGTCTGGATGTCATTAGCAAGCTAACGCGCGAAAAGGCCGACCCCAACGCAACGGCAGTTGAAATAGGC
CCCGTTATCAATGCAGCTATTTGCTCTGGCGTCGCGGATGCTGTCTACCGGCTCGTCGAGTGTGGTGCGAGATTT
GATGTGATTCCAGGGCCTTCAGACGATTGGTGCGGTCCTGTAGAACTTGCTGCCTTGCACTGGAACCTGCCCATG
ATTGAGTCTCTGATTGAAAAGAGCGGGGGCAAAATTCCTGCCGAGCAGTATAGCAGGGCTTTGATACAGGCGGCG
TATGGTGGCAGGAATGACGTTTTGAAGAGGCTGCTTGAATTCGATCACTCTCGTCAAGTCTTTCAGAACGCACTC
GAGGCGGCGGGCGAGGAAGAGAATTGGGAGATTTGCAAGATGATTTTGGGTTTGGAAAAGTGCAAAGGGCTGGAG
TTGGATTGTGAGGAACTCTTTTTTCAAGCAGCCAGTTGCATCGAGTCACCGGTGTCGGTCCTTGAAGAGATTTGG
GGGTATACTGGCGGCTTCATCTCCGAAACAATACTTGCCAAATCACTATACGACGCCACCGATATGGAAAAGGAA
GACACGGTCAAATTCCTGCTAGAAACGTGCCACGCCAGTCCCGAGGCTACAGGTGAAGAATTTGGAAACGCCCTG
ACAGCTGCTGCTTATGACGGTGTGGAAAAGATTGTCTTGATGCTACTCGACGCCGGCGCCGAGGTCAACTCACCC
AACGGCTGGGCTCTCCAGGAAGCCGCAGCACAGGGCAATTTGAATATTGTCAAGATACTCCTAGACCGAGGAGCC
GAGGTCAATGCCGAGATTAACAATGGGGGCTTCCCGCCGGGAACCGCGCTTCAGGGGGCCTGCGAGGCAGCCGAG
CCCGAGATTGTCGACCTGCTACTCGCTCGAAACGCCAACCCGAATCTTGGCTTGGGCTCCGAGTCGCCCCCCGTA
GTAGCCGCGGCGCTCCGGGGAGCTGACGACATCTTGGAGAAGCTGGTCAAGGCTCGAGCCAAAGTTGACGTTGTT
GACGGTGATGGGGAGACGACGCTGCTCAATAGGGCCACGGCCATCTTGTCAGTGGAATCGTTGCAGCTGCTTCTC
GACGCTGGAGCAAATGTAAACTTTGCCGACGAGAATGGCAATACCCCATTGATTGTTGCAGCTGGCATAAACGAA
GCAGACGCAGTCCAGCTCTTTCTCGATTACGGGGCTGATATTCTATACGTCAATGAGGATGGCAAGAATGCGATG
CAGGAAGCCTTTGAGAATGAGAGTGAAGAGTCTCTCAAGATACTGATTGACCGCGTGTCGAGTATCTTTTCACTG
CTTAAAACGGAGCGGGATACAGGAAGTGCCGAAATCGCAAGCTTCATGCGCAACGCCTTTGGACCGTCCAAGAAT
AGAAGCGTCGAGATGGGCTGTGAAGAGCCGAAGCAGCAGCCAGAAGACAATGTCGTCAAAGAAACTCCTCCGCTT
AATTATGAAGGGTGTGAGAGGGAGCTTCAAGGTAGCAAACGGCCCATGGCGGTGCCCAACTTTTACCAAACGTGT
TTGGACCAACCGCCGTCGCCTATGCGCGAAGCAAATGAGACTCTTTACCAGCAAGAGCAGCAAATAGCAACGTAT
GAGGCGTCTCAGCAAGTCAAAAAGGCCGAATACATGCACCAAGACGCAGGCCAACTACAACATGCCAGCCCTTCT
CAGCCCACGCCCACGCCCTCCAATGAATCCAGCACGTCGAATCGAATACCACGAAGACCTGTTGGGGATCAAGGG
TCGACGGGACTCTCTCCTAGCCAGCTTCATCAAACAACCCACTCTACTCCAAATCCATCGCAGCAAGAGCCTGCG
GAGCCCCAGTGGCATGCACCCAACAATAGCCCGGGACAGCCGAGCGCCCAGGCATGGCTAGGTCAAGAAGAGTAT
TGGCACGCACCTGGTACAAGATTTGATGGAGGTGCGAGAGTTGACAGTTTGGAGCAACATCACGAGCCGGGCTCT
AAGCAAAAGTGGCAGGCCTTGAAACCTTTTAATCGGCTAGCGCTGAATGACATGATGGACAAGACACTGGAGAGG
ACGGGGCTTGATAAAACCATGGACAAGGCGGTGGAAAAGGGAAAGTCTTTTTTGAGCAGAAGATAG
Transcript >OphauB2|1458
ATGTCACAACCGGCAAAGCCAAGTCGCAGGGGAACCATGGAGTGGCCTCAGGGCGCCAGCCCCTATGATGCTATG
CAACAGGGTGTCACGGTGCTGCATCCCAGTGGTAAGGAGGCACAAGACAAGACAAAGATTGATGTGGTGCTGGTT
CCCGGCCTGGGCGCCAATCCAGAAAAGAGCTGGATGTGGCCAAAGGGAGACTTTAGTTGGCCGACGGATGCAAAA
GGCCTCGTCGGCGACAATCCCGAGGCACGTATCCTGCTGCACATGTACGAGTCTGCGTGGATTGGCCAACGAAAG
GTCAACCAAAGCATCGTCAACGCGGCCAAATCACTGCTCCATGGCCTAGATCATTTTTCACCCCTCAAAGGAAAA
ACGAGACGACCAGTTGTATTTATCGGCCACAGCATGGGGGGCCTTGTAATTGCAAAGGCCGTGACGCTGATGAAG
AAGAACTCTGAGCGGTGGCCCAATATGCTCGAGGCGGTTGCCGGCGCCGCATTTTTCGGTACGCCCTTTCGAGGC
GCCGACTCGGCTAGTTGGGCAGGCATCTTTGCCAAGTTTAGTAACAGTGAATTCGGCACGGATTTAAAGTCTCAG
CTACTCAGCCTCATGAACCCTCAGTCCGGGGAGATTCACGAGCTGAGAAACGACTTTAACTTGCTGGCTACTACG
CTGCAACCCCCAATCAAGCTTTGTTGCTTCTGGGAACAACATCCAACAAACCCAGCCAATTTTGCACGTTCGGCC
GATCCCTCCGGTCTCATCAGCCACCTTGTGCCCCGGGGTGTCATCACCGAGATTGTCAGTGAGCAATCGGCGACT
CTGGATGGGGCAACGTCAATCGGTCTTGCGTGCGACCATCGCGGACTGGTCAAGTTTAGCGGACCCAAGGATAAG
AACTGGATGATGGGGGTGCGCGCTCCTCTCAAAGAGATAATTAGCGAGGGCCCTGCTGTTGTCAGGAAGCGGCTC
ATGGCTATTCGCGATATCGACCATCAGCTGATTGGCAAGATAACAAAAGCCCTCCAGACTGGCCCAGTTGATCAG
AAGCGCAACTCCCTCTCAAAGATTTTCAAGCCGTCCTCGTGGATCCCCAAAGAGCAGGAATTTGTCGAGTGGCTC
GACCGGGCTTGGATCCGTGGCCCCCAGGGCGAGGACAAGAATCAAGATCAGGACCCTGTAGGCTTGGATCCGCTA
GGCAGTTATATCTGGATTCGGGGACCGCAGGGTCGTGGCAAGACGGGCGCTACGCTGGCTGCCATTGCCGAGGTT
GAAGACATGCAACTGAAAGCACAGCTAAGAAACCCTGATGACCAAGTGTTCAAGGCATACTTCTTTTGCAGTGAA
GGGGGTGAATATTGCACGGCAGAGGACCTTTTAAAGTCTATCATTACTCAGCTCATTGACCAGGAAAGGATGCTG
GCCGCTTACGCCAAGCAGTTTGTCAGTGACAAAGACAAGGACAAGGATAGCAAGGACCAACATTCCAAGCCTGCT
GCCCAGGCGACAGTCGAGAATCTATGGCGAGCCTTGCACGATATGCTCTGGGAGGAGTTGTCTGGGCCCAGGACA
CGTGTCTATTTTTTACTCAACAACCTGCACGCCCTCCCACGGCCTTCTGAATCGACAAACAAGCTGCTAAAGTAC
ATCAACGAGGCACTCACTCCCGATGTCAAGGGCAACACCCAATGGCCTCGCTCTACATGCTGGTTCATCACCAGC
AGAGAAGGCGTGGGATGCATCGACAACGCATTGGATGTCAGGGGCAAGCGACTCATCAACCTCATGGACCCCAAG
TACGAAGACCAGGTGCAACGTGAGCTGCGCAAATACGCAAAGACTGGTCTTGATAGTCTTGCCACGAAAAAGAAA
TACAGCAAGGCGCTGCGATATCTTACTGGAGGCCTGATTGGAGGGCGGGCGAGCAGTACCCAGTGGATCGACGTC
ATGTACATGCTGCTAGAGGAGCTTCCGAATAGCGAGGACGATGCCCAAGTCCGCTCAGAGCTCGAGGCCATGCCG
CAGGAGCTCAAGTCTCTACTGACGCATTCATGGCAGGGCTTCTTCAGATCCAACGCCGGCGCCATGCAAAACATG
AAGGAGATGCTCCGTACCTTGGTCTTGACATATGACGACCCAACCGAGGCGGAGCTGGCGGTGCTGGCAGGCTTT
GCATCAAGCCCAAAACGAAAAGGCGAGCTGCGCGCCCTCGTCGACAAATGCAAGCCGTTGCTGCGTACTCGTGTC
GAGCACTTGATGGAGCACTCCAAGGAGCTTTTAGGTGTTGTTCCCGAGGAGACAGCAAGCCAAAATGAAAGGGCA
GCTACTAATGATGCTTCTGAGAGTGGTGTGCCGTCGGAAGGCGAGCATGGCGAAGAGGAGGAGGAGTATGTCGTC
GACACCGAGTCAGACGACTTGCAGATGGACAATGCTAAGACGAGCTACTCCGTCAAGTATTGGCTGAAACACGCA
AGCGAGGCAACCCTCGAGGTTGCGCAGCAACTCAGTCAGGAGCAATACTTTTGGAAACCAGACTCGCCTGTCCGA
TGCAGGTGGCTAGACGAGTACTCGAGGACCGAGAACACTTTTATCTACCTCGACATCAAATCCATGACGGGCCTT
CACATTGCGTGTTCGATAGGTTACCAGGAACTCGTCGAAGCGTTGATCCAAGAGGGCTACAAAGACCAGATTAAT
GTCCATGACAGCCTTGAAAATACACCATTACATTTGGCGGCCTTTTTTGATCAGGGCGAAATTATCGACGTGCTA
CTGCGCCACGGCGCCAATGTCAACGACCAGGGCAGCACGGGCGTCGAGGAAACTCCATTGCACATGGCTGCCCAT
CAAGGCCGTCTGGATGTCATTAGCAAGCTAACGCGCGAAAAGGCCGACCCCAACGCAACGGCAGTTGAAATAGGC
CCCGTTATCAATGCAGCTATTTGCTCTGGCGTCGCGGATGCTGTCTACCGGCTCGTCGAGTGTGGTGCGAGATTT
GATGTGATTCCAGGGCCTTCAGACGATTGGTGCGGTCCTGTAGAACTTGCTGCCTTGCACTGGAACCTGCCCATG
ATTGAGTCTCTGATTGAAAAGAGCGGGGGCAAAATTCCTGCCGAGCAGTATAGCAGGGCTTTGATACAGGCGGCG
TATGGTGGCAGGAATGACGTTTTGAAGAGGCTGCTTGAATTCGATCACTCTCGTCAAGTCTTTCAGAACGCACTC
GAGGCGGCGGGCGAGGAAGAGAATTGGGAGATTTGCAAGATGATTTTGGGTTTGGAAAAGTGCAAAGGGCTGGAG
TTGGATTGTGAGGAACTCTTTTTTCAAGCAGCCAGTTGCATCGAGTCACCGGTGTCGGTCCTTGAAGAGATTTGG
GGGTATACTGGCGGCTTCATCTCCGAAACAATACTTGCCAAATCACTATACGACGCCACCGATATGGAAAAGGAA
GACACGGTCAAATTCCTGCTAGAAACGTGCCACGCCAGTCCCGAGGCTACAGGTGAAGAATTTGGAAACGCCCTG
ACAGCTGCTGCTTATGACGGTGTGGAAAAGATTGTCTTGATGCTACTCGACGCCGGCGCCGAGGTCAACTCACCC
AACGGCTGGGCTCTCCAGGAAGCCGCAGCACAGGGCAATTTGAATATTGTCAAGATACTCCTAGACCGAGGAGCC
GAGGTCAATGCCGAGATTAACAATGGGGGCTTCCCGCCGGGAACCGCGCTTCAGGGGGCCTGCGAGGCAGCCGAG
CCCGAGATTGTCGACCTGCTACTCGCTCGAAACGCCAACCCGAATCTTGGCTTGGGCTCCGAGTCGCCCCCCGTA
GTAGCCGCGGCGCTCCGGGGAGCTGACGACATCTTGGAGAAGCTGGTCAAGGCTCGAGCCAAAGTTGACGTTGTT
GACGGTGATGGGGAGACGACGCTGCTCAATAGGGCCACGGCCATCTTGTCAGTGGAATCGTTGCAGCTGCTTCTC
GACGCTGGAGCAAATGTAAACTTTGCCGACGAGAATGGCAATACCCCATTGATTGTTGCAGCTGGCATAAACGAA
GCAGACGCAGTCCAGCTCTTTCTCGATTACGGGGCTGATATTCTATACGTCAATGAGGATGGCAAGAATGCGATG
CAGGAAGCCTTTGAGAATGAGAGTGAAGAGTCTCTCAAGATACTGATTGACCGCGTGTCGAGTATCTTTTCACTG
CTTAAAACGGAGCGGGATACAGGAAGTGCCGAAATCGCAAGCTTCATGCGCAACGCCTTTGGACCGTCCAAGAAT
AGAAGCGTCGAGATGGGCTGTGAAGAGCCGAAGCAGCAGCCAGAAGACAATGTCGTCAAAGAAACTCCTCCGCTT
AATTATGAAGGGTGTGAGAGGGAGCTTCAAGGTAGCAAACGGCCCATGGCGGTGCCCAACTTTTACCAAACGTGT
TTGGACCAACCGCCGTCGCCTATGCGCGAAGCAAATGAGACTCTTTACCAGCAAGAGCAGCAAATAGCAACGTAT
GAGGCGTCTCAGCAAGTCAAAAAGGCCGAATACATGCACCAAGACGCAGGCCAACTACAACATGCCAGCCCTTCT
CAGCCCACGCCCACGCCCTCCAATGAATCCAGCACGTCGAATCGAATACCACGAAGACCTGTTGGGGATCAAGGG
TCGACGGGACTCTCTCCTAGCCAGCTTCATCAAACAACCCACTCTACTCCAAATCCATCGCAGCAAGAGCCTGCG
GAGCCCCAGTGGCATGCACCCAACAATAGCCCGGGACAGCCGAGCGCCCAGGCATGGCTAGGTCAAGAAGAGTAT
TGGCACGCACCTGGTACAAGATTTGATGGAGGTGCGAGAGTTGACAGTTTGGAGCAACATCACGAGCCGGGCTCT
AAGCAAAAGTGGCAGGCCTTGAAACCTTTTAATCGGCTAGCGCTGAATGACATGATGGACAAGACACTGGAGAGG
ACGGGGCTTGATAAAACCATGGACAAGGCGGTGGAAAAGGGAAAGTCTTTTTTGAGCAGAAGATAG
Gene >OphauB2|1458
ATGTCACAACCGGCAAAGCCAAGTCGCAGGGGAACCATGGAGTGGCCTCAGGGCGCCAGCCCCTATGATGCTATG
CAACAGGGTGTCACGGTGCTGCATCCCAGTGGTAAGGAGGCACAAGACAAGACAAAGATTGAGTAGGCAAAATGA
CTACCACTATCAGCCAAATTCTCAAGCTGACGATCTCTCAGTGTGGTGCTGGTTCCCGGCCTGGGCGCCAATCCA
GAAAAGAGCTGGATGTGGCCAAAGGGAGACTTTAGTTGGCCGACGGATGCAAAAGGCCTCGTCGGCGACAATCCC
GAGGCACGTATCCTGCTGCACATGTACGAGTCTGCGTGGATTGGCCAACGAAAGGTCAACCAAAGCATCGTCAAC
GCGGCCAAATCACTGCTCCATGGCCTAGATCATTTTTCACCCCTCAAAGGAAAAACGAGACGACCAGTTGTATTT
ATCGGCCACAGCATGGGGGGCCTTGTAATTGCAAAGGCCGTGACGCTGATGAAGAAGAACTCTGAGCGGTGGCCC
AATATGCTCGAGGCGGTTGCCGGCGCCGCATTTTTCGGTACGCCCTTTCGAGGCGCCGACTCGGCTAGTTGGGCA
GGCATCTTTGCCAAGTTTAGTAACAGTGAATTCGGCACGGATTTAAAGTCTCAGCTACTCAGCCTCATGAACCCT
CAGTCCGGGGAGATTCACGAGCTGAGAAACGACTTTAACTTGCTGGCTACTACGCTGCAACCCCCAATCAAGCTT
TGTTGCTTCTGGGAACAACATCCAACAAACCCAGCCAATTTTGCACGTTCGGCCGATCCCTCCGGTCTCATCAGC
CACCTTGTGCCCCGGGGTGTCATCACCGAGATTGTCAGTGAGCAATCGGCGACTCTGGATGGGGCAACGTCAATC
GGTCTTGCGTGCGACCATCGCGGACTGGTCAAGTTTAGCGGACCCAAGGATAAGAACTGGATGATGGGGGTGCGC
GCTCCTCTCAAAGAGATAATTAGCGAGGGCCCTGCTGTTGTCAGGAAGCGGCTCATGGCTATTCGCGATATCGAC
CATCAGCTGATTGGCAAGATAACAAAAGCCCTCCAGACTGGCCCAGTTGATCAGAAGCGCAACTCCCTCTCAAAG
ATTTTCAAGCCGTCCTCGTGGATCCCCAAAGAGCAGGAATTTGTCGAGTGGCTCGACCGGGCTTGGATCCGTGGC
CCCCAGGGCGAGGACAAGAATCAAGATCAGGACCCTGTAGGCTTGGATCCGCTAGGCAGTTATATCTGGATTCGG
GGACCGCAGGGTCGTGGCAAGACGGGCGCTACGCTGGCTGCCATTGCCGAGGTTGAAGACATGCAACTGAAAGCA
CAGCTAAGAAACCCTGATGACCAAGTGTTCAAGGCATACTTCTTTTGCAGTGAAGGGGGTGAATATTGCACGGCA
GAGGACCTTTTAAAGTCTATCATTACTCAGCTCATTGACCAGGAAAGGATGCTGGCCGCTTACGCCAAGCAGTTT
GTCAGTGACAAAGACAAGGACAAGGATAGCAAGGACCAACATTCCAAGCCTGCTGCCCAGGCGACAGTCGAGAAT
CTATGGCGAGCCTTGCACGATATGCTCTGGGAGGAGTTGTCTGGGCCCAGGACACGTGTCTATTTTTTACTCAAC
AACCTGCACGCCCTCCCACGGCCTTCTGAATCGACAAACAAGCTGCTAAAGTACATCAACGAGGCACTCACTCCC
GATGTCAAGGGCAACACCCAATGGCCTCGCTCTACATGCTGGTTCATCACCAGCAGAGAAGGCGTGGGATGCATC
GACAACGCATTGGATGTCAGGGGCAAGCGACTCATCAACCTCATGGACCCCAAGTACGAAGACCAGGTGCAACGT
GAGCTGCGCAAATACGCAAAGACTGGTCTTGATAGTCTTGCCACGAAAAAGAAATACAGCAAGGCGCTGCGATAT
CTTACTGGAGGCCTGATTGGAGGGCGGGCGAGCAGTACCCAGTGGATCGACGTCATGTACATGCTGCTAGAGGAG
CTTCCGAATAGCGAGGACGATGCCCAAGTCCGCTCAGAGCTCGAGGCCATGCCGCAGGAGCTCAAGTCTCTACTG
ACGCATTCATGGCAGGGCTTCTTCAGATCCAACGCCGGCGCCATGCAAAACATGAAGGAGATGCTCCGTACCTTG
GTCTTGACATATGACGACCCAACCGAGGCGGAGCTGGCGGTGCTGGCAGGCTTTGCATCAAGCCCAAAACGAAAA
GGCGAGCTGCGCGCCCTCGTCGACAAATGCAAGCCGTTGCTGCGTACTCGTGTCGTGCGTGCTCATGGGCCTGTG
CATACGACTGTGGGCTTTGTAAATGCTGTTGTCAAGGAGCACTTGATGGAGCACTCCAAGGAGCTTTTAGGGTTA
AATGACGAGGAGAAAAAATTTCAGCACGGCGTTATAGCTCATCGCTGCTTTGAAGACTTGGATAGCCGTTTTAGT
GTTGTTCCCGAGGAGACAGCAAGCCAAAATGAAAGGGCAGCTACTAATGATGCTTCTGAGAGTGGTGTGCCGTCG
GAAGGCGAGCATGGCGAAGAGGAGGAGGAGTATGTCGTCGACACCGAGTCAGACGACTTGCAGATGGACAATGCT
AAGACGAGCTACTCCGTCAAGTATTGGCTGAAACACGCAAGCGAGGCAACCCTCGAGGTTGCGCAGCAACTCAGT
CAGGAGCAATACTTTTGGAAACCAGACTCGCCTGTCCGATGCAGGTGGCTAGACGAGTACTCGAGGACCGAGAAC
ACTTTTATCTACCTCGACATCAAATCCATGACGGGCCTTCACATTGCGTGTTCGATAGGTTACCAGGAACTCGTC
GAAGCGTTGATCCAAGAGGGCTACAAAGACCAGATTAATGTCCATGACAGCCTTGAAAATACACCAGTAAGTGCG
AAAACTGTAAGTGACAAATTGATAAAAGACATAAACTAACCCAAGGGCTGTCTTTAGTTACATTTGGCGGCCTTT
TTTGATCAGGGCGAAATTATCGACGTGCTACTGCGCCACGGCGCCAATGTCAACGACCAGGGCAGCACGGGCGTC
GAGGAAACTCCATTGCACATGGCTGCCCATCAAGGCCGTCTGGATGTCATTAGCAAGCTAACGCGCGAAAAGGCC
GACCCCAACGCAACGGCAGTTGAAATAGGCCCCGTTATCAATGCAGCTATTTGCTCTGGCGTCGCGGATGCTGTC
TACCGGCTCGTCGAGTGTGGTGCGAGATTTGATGTGATTCCAGGGCCTTCAGACGATTGGTGCGGTCCTGTAGAA
CTTGCTGCCTTGCACTGGAACCTGCCCATGATTGAGTCTCTGATTGAAAAGAGCGGGGGCAAAATTCCTGCCGAG
CAGTATAGCAGGGCTTTGATACAGGCGGCGTATGGTGGCAGGAATGACGTTTTGAAGAGGCTGCTTGAATTCGAT
CACTCTCGTCAAGTCTTTCAGAACGCACTCGAGGCGGCGGGCGAGGAAGAGAATTGGGAGATTTGCAAGATGATT
TTGGGTTTGGAAAAGTGCAAAGGGCTGGAGTTGGATTGTGAGGAACTCTTTTTTCAAGCAGCCAGTTGCATCGAG
TCACCGGTGTCGGTCCTTGAAGAGATTTGGGGGTATACTGGCGGCTTCATCTCCGAAACAATACTTGCCAAATCA
CTATACGACGCCACCGATATGGAAAAGGAAGACACGGTCAAATTCCTGCTAGAAACGTGCCACGCCAGTCCCGAG
GCTACAGGTGAAGAGTAGGTGGACCATGATTTATTTCAATGTCGAGTGCATCATGACGGGAAGCTAACCCATGAC
AATAGATTTGGAAACGCCCTGACAGCTGCTGCTTATGACGGTGTGGAAAAGATTGTCTTGATGCTACTCGACGCC
GGCGCCGAGGTCAACTCACCCAACGGCTGGGCTCTCCAGGAAGCCGCAGCACAGGGCAATTTGAATATTGTCAAG
ATACTCCTAGACCGAGGAGCCGAGGTCAATGCCGAGATTAACAATGGGGGCTTCCCGCCGGGAACCGCGCTTCAG
GGGGCCTGCGAGGCAGCCGAGCCCGAGATTGTCGACCTGCTACTCGCTCGAAACGCCAACCCGAATCTTGGCTTG
GGCTCCGAGTCGCCCCCCGTAGTAGCCGCGGCGCTCCGGGGAGCTGACGACATCTTGGAGAAGCTGGTCAAGGCT
CGAGCCAAAGTTGACGTTGTTGACGGTGATGGGGAGACGACGCTGCTCAATAGGGCCACGGCCATCTTGTCAGTG
GAATCGTTGCAGCTGCTTCTCGACGCTGGAGCAAATGTAAACTTTGCCGACGAGAATGGCAATACCCCATTGATT
GTTGCAGCTGGCATAAACGAAGCAGACGCAGTCCAGCTCTTTCTCGATTACGGGGCTGATATTCTATACGTCAAT
GAGGATGGCAAGAATGCGATGCAGGAAGCCTTTGAGAATGAGAGTGAAGAGTCTCTCAAGATACTGATTGACCGC
GTGTCGAGTATCTTTTCACTGCTTAAAACGGAGCGGGATACAGGAAGTGCCGAAATCGCAAGCTTCATGCGCAAC
GCCTTTGGACCGTCCAAGAATAGAAGCGTCGAGATGGGCTGTGAAGAGCCGAAGCAGCAGCCAGAAGACAATGTC
GTCAAAGAAACTCCTCCGCTTAATTATGAAGGGTGTGAGAGGGAGCTTCAAGGTAGCAAACGGCCCATGGCGGTG
CCCAACTTTTACCAAACGTGTTTGGACCAACCGCCGTCGCCTATGCGCGAAGCAAATGAGACTCTTTACCAGCAA
GAGCAGCAAATAGCAACGTATGAGGCGTCTCAGCAAGTCAAAAAGGCCGAATACATGCACCAAGACGCAGGCCAA
CTACAACATGCCAGCCCTTCTCAGCCCACGCCCACGCCCTCCAATGAATCCAGCACGTCGAATCGAATACCACGA
AGACCTGTTGGGGATCAAGGGTCGACGGGACTCTCTCCTAGCCAGCTTCATCAAACAACCCACTCTACTCCAAAT
CCATCGCAGCAAGAGCCTGCGGAGCCCCAGTGGCATGCACCCAACAATAGCCCGGGACAGCCGAGCGCCCAGGCA
TGGCTAGGTCAAGAAGAGTATTGGCACGCACCTGGTACAAGATTTGATGGAGGTGCGAGAGTTGACAGTTTGGAG
CAACATCACGAGCCGGGCTCTAAGCAAAAGTGGCAGGCCTTGAAACCTTTTAATCGGCTAGCGCTGAATGACATG
ATGGACAAGACACTGGAGAGGACGGGGCTTGATAAAACCATGGACAAGGCGGTGGAAAAGGGAAAGTCTTTTTTG
AGCAGAAGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail