Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1457
Gene name
LocationContig_14:32281..33076
Strand+
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 3.5E-20 1 79
PF00550 PP-binding Phosphopantetheine attachment site 2.4E-05 194 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 261 7.0E-24
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1 258 1.0E-12
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1 261 2.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 260 2.0E-11
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 31 258 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 261 7.0E-24
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1 258 1.0E-12
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1 261 2.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 260 2.0E-11
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 31 258 3.0E-11
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1 261 5.0E-11
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 9 255 2.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 28 258 4.0E-08
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 6 139 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1457
MTHGQWQTTIKSKVDSSWNLDRLLPHDLDFFILLSSVSSTNGFAAQSNYTAACVFQDVLAQSRCANGQRGVSIGL
SIVRDAGYYATSDILHKNDAITKNVKPIDMKQLLATLSIYCDPNQPPSSSHVLLGWTTPADHAAKGKAPPEYMNR
PLFAPFQNTIRQTASSTDDEADASTRFKVEEDADKRTQIVLDALVVKLARAMSISPDQVDAQNPPTYYSVDSLSA
MNLRHWAKRDFGAALETSEIFGATSVAAVVELIVSKSTC*
Coding >OphauB2|1457
ATGACGCACGGCCAGTGGCAGACGACAATCAAGTCCAAGGTTGACTCGTCCTGGAACCTTGACCGTCTGCTACCC
CATGACCTAGATTTTTTCATCCTCTTGTCCTCAGTTAGCAGCACCAATGGCTTTGCCGCCCAGTCAAACTATACT
GCTGCCTGCGTCTTCCAAGATGTGCTCGCCCAAAGCCGTTGCGCCAATGGTCAAAGAGGCGTCTCCATTGGCCTA
TCTATTGTACGAGACGCGGGATACTATGCCACCTCTGACATCTTGCACAAGAATGACGCCATTACCAAAAACGTC
AAGCCCATCGACATGAAGCAGCTGCTTGCTACCTTGAGCATCTACTGCGATCCGAATCAACCCCCCTCCTCCAGC
CACGTTCTTTTGGGCTGGACCACTCCCGCCGATCACGCAGCAAAGGGTAAAGCACCGCCTGAATACATGAATCGA
CCTCTGTTTGCACCCTTTCAAAACACCATACGTCAGACTGCATCTTCCACAGATGATGAAGCAGACGCGAGCACG
CGCTTCAAGGTAGAAGAGGATGCGGACAAGCGCACGCAAATTGTTCTCGACGCTCTAGTTGTCAAGCTGGCGCGC
GCCATGTCTATTTCTCCGGACCAGGTCGATGCACAGAATCCGCCGACATATTATAGCGTCGACTCTCTATCTGCC
ATGAATTTACGCCACTGGGCCAAGAGGGATTTTGGCGCGGCTTTGGAAACGTCGGAAATCTTTGGTGCGACGTCT
GTTGCTGCGGTTGTAGAGTTGATTGTGTCAAAGTCTACATGTTGA
Transcript >OphauB2|1457
ATGACGCACGGCCAGTGGCAGACGACAATCAAGTCCAAGGTTGACTCGTCCTGGAACCTTGACCGTCTGCTACCC
CATGACCTAGATTTTTTCATCCTCTTGTCCTCAGTTAGCAGCACCAATGGCTTTGCCGCCCAGTCAAACTATACT
GCTGCCTGCGTCTTCCAAGATGTGCTCGCCCAAAGCCGTTGCGCCAATGGTCAAAGAGGCGTCTCCATTGGCCTA
TCTATTGTACGAGACGCGGGATACTATGCCACCTCTGACATCTTGCACAAGAATGACGCCATTACCAAAAACGTC
AAGCCCATCGACATGAAGCAGCTGCTTGCTACCTTGAGCATCTACTGCGATCCGAATCAACCCCCCTCCTCCAGC
CACGTTCTTTTGGGCTGGACCACTCCCGCCGATCACGCAGCAAAGGGTAAAGCACCGCCTGAATACATGAATCGA
CCTCTGTTTGCACCCTTTCAAAACACCATACGTCAGACTGCATCTTCCACAGATGATGAAGCAGACGCGAGCACG
CGCTTCAAGGTAGAAGAGGATGCGGACAAGCGCACGCAAATTGTTCTCGACGCTCTAGTTGTCAAGCTGGCGCGC
GCCATGTCTATTTCTCCGGACCAGGTCGATGCACAGAATCCGCCGACATATTATAGCGTCGACTCTCTATCTGCC
ATGAATTTACGCCACTGGGCCAAGAGGGATTTTGGCGCGGCTTTGGAAACGTCGGAAATCTTTGGTGCGACGTCT
GTTGCTGCGGTTGTAGAGTTGATTGTGTCAAAGTCTACATGTTGA
Gene >OphauB2|1457
ATGACGCACGGCCAGTGGCAGACGACAATCAAGTCCAAGGTTGACTCGTCCTGGAACCTTGACCGTCTGCTACCC
CATGACCTAGATTTTTTCATCCTCTTGTCCTCAGTTAGCAGCACCAATGGCTTTGCCGCCCAGTCAAACTATACT
GCTGCCTGCGTCTTCCAAGATGTGCTCGCCCAAAGCCGTTGCGCCAATGGTCAAAGAGGCGTCTCCATTGGCCTA
TCTATTGTACGAGACGCGGGATACTATGCCACCTCTGACATCTTGCACAAGAATGACGCCATTACCAAAAACGTC
AAGCCCATCGACATGAAGCAGCTGCTTGCTACCTTGAGCATCTACTGCGATCCGAATCAACCCCCCTCCTCCAGC
CACGTTCTTTTGGGCTGGACCACTCCCGCCGATCACGCAGCAAAGGGTAAAGCACCGCCTGAATACATGAATCGA
CCTCTGTTTGCACCCTTTCAAAACACCATACGTCAGACTGCATCTTCCACAGATGATGAAGCAGACGCGAGCACG
CGCTTCAAGGTAGAAGAGGATGCGGACAAGCGCACGCAAATTGTTCTCGACGCTCTAGTTGTCAAGCTGGCGCGC
GCCATGTCTATTTCTCCGGACCAGGTCGATGCACAGAATCCGCCGACATATTATAGCGTCGACTCTCTATCTGCC
ATGAATTTACGCCACTGGGCCAAGAGGGATTTTGGCGCGGCTTTGGAAACGTCGGAAATCTTTGGTGCGACGTCT
GTTGCTGCGGTTGTAGAGTTGATTGTGTCAAAGTCTACATGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail