Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1456
Gene name
LocationContig_14:28046..31910
Strand+
Gene length (bp)3864
Transcript length (bp)3864
Coding sequence length (bp)3864
Protein length (aa) 1288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 5.9E-16 1 252
PF08242 Methyltransf_12 Methyltransferase domain 3.1E-14 540 649
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.2E-09 1076 1160
PF13489 Methyltransf_23 Methyltransferase domain 8.7E-09 526 700
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.0E-07 1124 1239
PF13847 Methyltransf_31 Methyltransferase domain 1.6E-07 535 655
PF13649 Methyltransf_25 Methyltransferase domain 1.7E-06 539 647
PF08241 Methyltransf_11 Methyltransferase domain 2.3E-05 540 650
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 9.5E-05 957 1017

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 440 1259 2.0E-82
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 478 849 7.0E-41
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 408 861 6.0E-37
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 465 861 2.0E-35
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 537 1238 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 440 1259 2.0E-82
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 478 849 7.0E-41
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 408 861 6.0E-37
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 465 861 2.0E-35
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 537 1238 3.0E-31
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 889 1268 5.0E-31
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 889 1268 5.0E-31
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 460 1229 5.0E-31
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 460 1229 1.0E-29
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 537 1238 3.0E-29
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 492 1238 1.0E-28
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 492 1238 2.0E-28
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 489 1269 2.0E-28
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 537 1238 3.0E-28
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 501 1251 4.0E-28
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 537 1238 4.0E-27
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 537 1238 7.0E-26
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 839 1266 1.0E-25
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 598 1162 3.0E-25
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 537 1165 5.0E-25
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 595 1238 4.0E-23
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 595 1238 1.0E-22
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 540 1251 1.0E-20
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 540 1181 7.0E-20
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 839 1265 6.0E-19
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 839 1265 7.0E-19
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 839 1265 7.0E-19
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 839 1265 7.0E-19
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 839 1265 7.0E-19
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 452 700 2.0E-18
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 479 725 3.0E-18
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 540 1181 6.0E-18
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 537 730 8.0E-18
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 537 730 2.0E-16
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 537 730 2.0E-16
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 927 1166 9.0E-16
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 530 700 1.0E-15
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 492 700 4.0E-15
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 537 765 4.0E-14
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 998 1273 2.0E-13
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 998 1273 5.0E-13
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 998 1187 6.0E-13
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 998 1235 7.0E-13
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 848 1251 9.0E-12
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 985 1157 1.0E-11
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1006 1250 3.0E-11
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 947 1181 4.0E-11
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 985 1160 6.0E-11
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 931 1248 6.0E-11
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 971 1228 7.0E-11
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 848 1251 1.0E-10
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1037 1231 1.0E-10
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 959 1141 2.0E-10
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 971 1228 5.0E-10
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 971 1228 9.0E-10
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 885 1211 1.0E-09
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 985 1203 1.0E-09
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 939 1160 1.0E-09
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 537 703 2.0E-09
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 939 1160 2.0E-09
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 959 1141 3.0E-09
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 836 1162 4.0E-09
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 540 703 5.0E-09
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 984 1163 9.0E-09
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 955 1103 8.0E-08
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 530 863 1.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 959 1141 1.0E-07
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 836 1238 1.0E-07
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 958 1160 2.0E-07
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 954 1160 3.0E-07
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 957 1124 3.0E-07
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 957 1124 3.0E-07
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 954 1226 3.0E-07
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 957 1128 6.0E-07
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 957 1124 9.0E-07
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 957 1124 9.0E-07
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 958 1189 1.0E-06
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 957 1124 1.0E-06
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 934 1168 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0008168 methyltransferase activity Yes
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1456
MQAARRASPLSSQISGFYIREARFKSAILISDEAEDANELVVQLRPLDKLGSRAATWSEVRIFAYSHSTCAECFQ
CIIRTDHGEAAVNKADTDEKELEAREMLGEYTTTREKCTHYLGPKAFYKDLERFSIRYSGCFKALQEAWWSPNGI
ATTCLEAKSRQHSTTSLVHPALLDAVMQAMQIGNGPEAVSGVTPTRMADAWFASTAWQQIDTGSIRCIKRASKRP
TGIFNQQSIHAVTDSGSILCAINVLETMQREAVGGAGDSTEGLLHRVEWKPQLSLLSPGELRRVCDADNIVRDEV
GMEEDNGKLDTVLGRVLCETLAEISNEGEERVRGHLSRYLEWMKHKVGQIAHETGHDGEERLQEAQTVDVWHEES
EDGFQKVEASQGSLAEGICHEKMENEFQQVEGSQLSLEEEPQQVEVCYEETKDELPQVRVCRKSFKEELQALQAC
NGKMKDKFHQWSLEEELHQVEALNPAWKLYTSLARQLKSILLGESNALDIMYGTGMADALYLDVFKPICDARLST
LLDLVSHQNPNLRVLEVGAGTGGLTSFILGFLQDKEMQTGTRAFSEYTYTDVSPSFFDTASDKWSALKDRMGFKV
FDLERSGASQGLEPGSYNLVIAGCVLHTTSNLPATIQGVRDMLKPNGRLLLVEPIAPESLAAGFPWGLLPGWWRG
EEEWRRLSALGDEERWEALLKENGFGGIDVCLRDYASEANRRISVMLTTVEPEIRGQDEGSIYVVVGDEAVGEQV
ELAEAVLSRRDQFGCVDGEMVLLKEMHTLETCDNDLVVFVGEIAKPLLGDMDSEILNHIRAMVAKAKRLFWVNAT
TEGDAAMPHFYLAQGLLRSLRSEMPSTQIISLTIEAQDLNPEFIFKYISTVVHDVFCSDSAEVEFIVRNGQLLTG
RAVQATVESKHLETLISPGLTTASWESSSQLKLHTGTPGDFDTLHFIQGDEGELRGDEVEIKVQAWAVTRQDVAV
AQGRENQEFGFECAGIVSRLGPECILGLQVGDRVVMITPGCMRTNPRASEQLVARIPDNVAMNEVVIMVASALTP
CYALLELARLQAGERVLVDDAASDAGQMAVRIALDRGAKVMATAQTSEEMDWVARELAIASDHVLRAGTSLGKQV
SRLTSGQGVDIVLNSGGADALASLLDCVAPHGKVVDLNRGDTGWTALLAQSRLAANMTLSSVNVRELLRAKPSRV
GAILRDTLDLVARQVLSCPTPLHVFPVSQVCQAFKSVNASNKTEAAVIGIDPLDTVKVRISPFKPPHPNAILTTV
YSALYQQVRLGG*
Coding >OphauB2|1456
ATGCAAGCAGCAAGACGAGCGAGCCCCTTGTCAAGCCAGATATCTGGATTTTATATTCGGGAAGCTAGATTCAAG
AGCGCCATTCTTATAAGCGACGAGGCAGAGGATGCCAACGAGCTAGTGGTGCAGCTGCGGCCACTCGACAAGCTC
GGCTCTAGGGCGGCAACATGGTCAGAGGTTAGGATTTTTGCATACAGCCACTCAACATGTGCAGAATGTTTCCAA
TGCATCATTCGAACAGACCATGGTGAAGCAGCCGTCAACAAGGCCGACACTGATGAAAAAGAGCTCGAGGCTCGT
GAAATGCTGGGCGAGTATACAACGACACGGGAAAAATGTACTCACTACCTTGGCCCCAAGGCATTCTACAAGGAC
CTTGAGAGATTCAGCATTCGGTACAGTGGCTGTTTCAAGGCCCTGCAAGAGGCGTGGTGGAGTCCTAATGGGATA
GCCACTACTTGTCTTGAGGCCAAATCTCGACAGCACAGCACCACGAGCCTAGTCCATCCTGCGCTTCTGGATGCA
GTAATGCAGGCGATGCAAATAGGCAATGGACCAGAGGCTGTTTCCGGTGTGACGCCGACGCGCATGGCCGACGCA
TGGTTTGCTTCCACGGCGTGGCAGCAAATAGACACTGGCAGCATTCGATGCATCAAGCGCGCGAGCAAACGACCC
ACCGGAATTTTCAACCAGCAGAGCATTCATGCCGTGACGGATAGCGGATCCATCTTGTGTGCTATTAATGTATTG
GAGACGATGCAGAGGGAAGCAGTGGGCGGTGCTGGCGATTCGACAGAAGGCTTGCTACACAGGGTCGAGTGGAAG
CCGCAGCTTAGTCTGCTGAGTCCTGGAGAGCTGCGTCGGGTGTGTGATGCGGATAACATTGTGAGGGATGAGGTG
GGAATGGAAGAGGATAATGGAAAGCTGGATACAGTTTTGGGAAGAGTCTTGTGTGAGACGTTGGCGGAGATTTCG
AATGAGGGGGAGGAGAGGGTGAGGGGTCATTTGTCAAGGTATTTGGAGTGGATGAAGCACAAGGTTGGCCAAATT
GCACATGAAACGGGTCATGATGGCGAGGAGAGATTGCAAGAGGCACAAACAGTCGACGTCTGGCATGAAGAGTCG
GAAGACGGGTTCCAAAAAGTGGAAGCCTCTCAGGGCAGCTTGGCAGAGGGGATTTGTCATGAGAAGATGGAAAAC
GAGTTTCAGCAAGTCGAGGGCTCTCAGTTGAGCTTGGAAGAGGAGCCCCAACAGGTCGAGGTCTGTTATGAGGAG
ACCAAAGACGAATTGCCGCAAGTCCGAGTCTGCCGGAAGAGCTTTAAAGAGGAGCTACAAGCATTGCAAGCCTGT
AATGGCAAGATGAAAGACAAATTTCATCAGTGGAGCTTGGAAGAAGAGCTACATCAAGTCGAGGCCCTCAACCCA
GCTTGGAAACTCTACACCAGCCTGGCCCGCCAGCTCAAGTCGATCCTGCTTGGCGAAAGCAATGCACTCGACATC
ATGTACGGCACCGGCATGGCCGACGCGCTCTACCTCGACGTCTTCAAGCCCATCTGCGACGCCCGCCTATCAACA
CTGCTCGATCTCGTCTCGCACCAAAACCCCAACCTGCGCGTCCTCGAAGTCGGCGCCGGTACAGGTGGCCTCACC
TCTTTTATTCTCGGCTTTTTGCAAGACAAGGAGATGCAGACGGGCACAAGAGCCTTTTCCGAGTACACCTACACC
GACGTCTCGCCCAGCTTCTTTGACACGGCGAGCGACAAGTGGTCTGCGCTAAAGGACCGCATGGGATTCAAAGTC
TTTGATCTGGAACGCTCGGGAGCGTCGCAGGGCCTAGAACCGGGCTCGTATAACCTTGTTATCGCGGGTTGTGTG
CTTCATACGACGAGTAATCTCCCAGCCACGATTCAGGGCGTGCGCGACATGCTCAAGCCAAACGGTCGCTTGCTT
CTTGTTGAGCCGATTGCGCCAGAGAGTCTTGCGGCGGGTTTTCCGTGGGGGCTGCTGCCAGGCTGGTGGCGCGGA
GAAGAGGAGTGGCGGCGGCTGTCTGCTCTAGGCGATGAAGAGCGATGGGAGGCGCTTTTAAAGGAGAATGGCTTT
GGAGGGATTGATGTTTGTCTGCGAGACTATGCGAGTGAGGCGAATCGGCGCATTAGCGTCATGTTGACGACTGTC
GAGCCAGAGATTCGAGGCCAAGACGAGGGCAGCATTTACGTTGTTGTGGGAGACGAGGCAGTTGGGGAACAAGTT
GAGCTTGCCGAAGCGGTGCTGTCTCGTCGAGATCAGTTTGGGTGTGTGGATGGGGAAATGGTGCTGCTGAAAGAG
ATGCATACTCTGGAGACGTGCGACAACGACCTCGTCGTCTTTGTCGGCGAGATTGCCAAGCCGCTTCTGGGAGAC
ATGGACAGCGAAATACTGAACCATATCCGCGCCATGGTGGCCAAGGCGAAGCGGTTGTTTTGGGTGAATGCCACG
ACGGAGGGCGATGCCGCCATGCCGCACTTTTACCTTGCTCAAGGCCTACTGCGCTCTCTTCGCAGCGAGATGCCC
TCCACGCAAATAATTTCGCTAACAATTGAAGCACAAGACTTGAATCCCGAGTTTATTTTCAAGTATATTTCCACC
GTTGTCCACGACGTCTTTTGCTCCGACTCGGCAGAAGTGGAATTCATTGTGCGCAACGGCCAGCTGCTCACTGGG
CGCGCTGTGCAAGCCACTGTGGAGAGCAAGCATCTAGAGACTCTCATTTCGCCAGGCCTCACCACTGCGTCGTGG
GAATCTAGCTCTCAGCTAAAGTTGCATACCGGCACGCCTGGCGATTTCGACACGCTGCACTTTATCCAAGGCGAC
GAGGGGGAATTGCGTGGAGACGAGGTGGAAATAAAAGTCCAGGCTTGGGCTGTCACTCGGCAAGATGTTGCAGTT
GCACAGGGTCGCGAGAATCAAGAGTTTGGGTTCGAGTGTGCCGGCATCGTCTCAAGACTGGGGCCTGAGTGTATC
TTGGGGCTTCAAGTTGGAGACCGCGTCGTCATGATTACGCCGGGGTGTATGAGGACGAATCCGCGCGCATCAGAA
CAGCTTGTGGCTAGGATTCCAGATAATGTGGCGATGAATGAGGTCGTCATCATGGTTGCGTCCGCGCTGACGCCT
TGTTATGCTTTGCTTGAGCTTGCTAGGCTTCAGGCGGGAGAGAGAGTCTTGGTTGACGATGCGGCGAGTGATGCG
GGTCAAATGGCCGTACGCATCGCGCTGGACCGAGGCGCCAAAGTCATGGCTACGGCTCAGACGAGTGAGGAGATG
GACTGGGTAGCCAGAGAGCTTGCCATTGCGTCAGACCATGTCTTGAGAGCAGGGACGTCGCTGGGGAAGCAAGTC
TCAAGGTTGACGAGTGGACAGGGAGTCGACATTGTTCTCAACTCTGGTGGAGCAGATGCTCTTGCATCGTTGCTC
GACTGCGTCGCTCCGCATGGCAAGGTGGTGGATCTGAACCGAGGAGATACAGGCTGGACAGCTCTCCTGGCACAA
TCGCGATTGGCGGCCAACATGACCCTGTCGTCTGTCAATGTCAGGGAACTGCTCAGGGCGAAACCAAGCCGTGTT
GGAGCCATTCTCAGGGATACACTCGATTTGGTGGCGCGGCAAGTCTTGAGCTGTCCTACGCCGCTTCATGTTTTT
CCCGTCTCGCAAGTCTGTCAGGCGTTTAAATCTGTCAATGCCAGCAACAAGACTGAAGCCGCAGTCATTGGCATC
GACCCTCTAGACACAGTCAAGGTACGCATTTCCCCCTTCAAACCCCCACACCCCAACGCTATACTCACAACCGTG
TATAGTGCGCTGTATCAACAAGTCCGTCTTGGAGGCTAG
Transcript >OphauB2|1456
ATGCAAGCAGCAAGACGAGCGAGCCCCTTGTCAAGCCAGATATCTGGATTTTATATTCGGGAAGCTAGATTCAAG
AGCGCCATTCTTATAAGCGACGAGGCAGAGGATGCCAACGAGCTAGTGGTGCAGCTGCGGCCACTCGACAAGCTC
GGCTCTAGGGCGGCAACATGGTCAGAGGTTAGGATTTTTGCATACAGCCACTCAACATGTGCAGAATGTTTCCAA
TGCATCATTCGAACAGACCATGGTGAAGCAGCCGTCAACAAGGCCGACACTGATGAAAAAGAGCTCGAGGCTCGT
GAAATGCTGGGCGAGTATACAACGACACGGGAAAAATGTACTCACTACCTTGGCCCCAAGGCATTCTACAAGGAC
CTTGAGAGATTCAGCATTCGGTACAGTGGCTGTTTCAAGGCCCTGCAAGAGGCGTGGTGGAGTCCTAATGGGATA
GCCACTACTTGTCTTGAGGCCAAATCTCGACAGCACAGCACCACGAGCCTAGTCCATCCTGCGCTTCTGGATGCA
GTAATGCAGGCGATGCAAATAGGCAATGGACCAGAGGCTGTTTCCGGTGTGACGCCGACGCGCATGGCCGACGCA
TGGTTTGCTTCCACGGCGTGGCAGCAAATAGACACTGGCAGCATTCGATGCATCAAGCGCGCGAGCAAACGACCC
ACCGGAATTTTCAACCAGCAGAGCATTCATGCCGTGACGGATAGCGGATCCATCTTGTGTGCTATTAATGTATTG
GAGACGATGCAGAGGGAAGCAGTGGGCGGTGCTGGCGATTCGACAGAAGGCTTGCTACACAGGGTCGAGTGGAAG
CCGCAGCTTAGTCTGCTGAGTCCTGGAGAGCTGCGTCGGGTGTGTGATGCGGATAACATTGTGAGGGATGAGGTG
GGAATGGAAGAGGATAATGGAAAGCTGGATACAGTTTTGGGAAGAGTCTTGTGTGAGACGTTGGCGGAGATTTCG
AATGAGGGGGAGGAGAGGGTGAGGGGTCATTTGTCAAGGTATTTGGAGTGGATGAAGCACAAGGTTGGCCAAATT
GCACATGAAACGGGTCATGATGGCGAGGAGAGATTGCAAGAGGCACAAACAGTCGACGTCTGGCATGAAGAGTCG
GAAGACGGGTTCCAAAAAGTGGAAGCCTCTCAGGGCAGCTTGGCAGAGGGGATTTGTCATGAGAAGATGGAAAAC
GAGTTTCAGCAAGTCGAGGGCTCTCAGTTGAGCTTGGAAGAGGAGCCCCAACAGGTCGAGGTCTGTTATGAGGAG
ACCAAAGACGAATTGCCGCAAGTCCGAGTCTGCCGGAAGAGCTTTAAAGAGGAGCTACAAGCATTGCAAGCCTGT
AATGGCAAGATGAAAGACAAATTTCATCAGTGGAGCTTGGAAGAAGAGCTACATCAAGTCGAGGCCCTCAACCCA
GCTTGGAAACTCTACACCAGCCTGGCCCGCCAGCTCAAGTCGATCCTGCTTGGCGAAAGCAATGCACTCGACATC
ATGTACGGCACCGGCATGGCCGACGCGCTCTACCTCGACGTCTTCAAGCCCATCTGCGACGCCCGCCTATCAACA
CTGCTCGATCTCGTCTCGCACCAAAACCCCAACCTGCGCGTCCTCGAAGTCGGCGCCGGTACAGGTGGCCTCACC
TCTTTTATTCTCGGCTTTTTGCAAGACAAGGAGATGCAGACGGGCACAAGAGCCTTTTCCGAGTACACCTACACC
GACGTCTCGCCCAGCTTCTTTGACACGGCGAGCGACAAGTGGTCTGCGCTAAAGGACCGCATGGGATTCAAAGTC
TTTGATCTGGAACGCTCGGGAGCGTCGCAGGGCCTAGAACCGGGCTCGTATAACCTTGTTATCGCGGGTTGTGTG
CTTCATACGACGAGTAATCTCCCAGCCACGATTCAGGGCGTGCGCGACATGCTCAAGCCAAACGGTCGCTTGCTT
CTTGTTGAGCCGATTGCGCCAGAGAGTCTTGCGGCGGGTTTTCCGTGGGGGCTGCTGCCAGGCTGGTGGCGCGGA
GAAGAGGAGTGGCGGCGGCTGTCTGCTCTAGGCGATGAAGAGCGATGGGAGGCGCTTTTAAAGGAGAATGGCTTT
GGAGGGATTGATGTTTGTCTGCGAGACTATGCGAGTGAGGCGAATCGGCGCATTAGCGTCATGTTGACGACTGTC
GAGCCAGAGATTCGAGGCCAAGACGAGGGCAGCATTTACGTTGTTGTGGGAGACGAGGCAGTTGGGGAACAAGTT
GAGCTTGCCGAAGCGGTGCTGTCTCGTCGAGATCAGTTTGGGTGTGTGGATGGGGAAATGGTGCTGCTGAAAGAG
ATGCATACTCTGGAGACGTGCGACAACGACCTCGTCGTCTTTGTCGGCGAGATTGCCAAGCCGCTTCTGGGAGAC
ATGGACAGCGAAATACTGAACCATATCCGCGCCATGGTGGCCAAGGCGAAGCGGTTGTTTTGGGTGAATGCCACG
ACGGAGGGCGATGCCGCCATGCCGCACTTTTACCTTGCTCAAGGCCTACTGCGCTCTCTTCGCAGCGAGATGCCC
TCCACGCAAATAATTTCGCTAACAATTGAAGCACAAGACTTGAATCCCGAGTTTATTTTCAAGTATATTTCCACC
GTTGTCCACGACGTCTTTTGCTCCGACTCGGCAGAAGTGGAATTCATTGTGCGCAACGGCCAGCTGCTCACTGGG
CGCGCTGTGCAAGCCACTGTGGAGAGCAAGCATCTAGAGACTCTCATTTCGCCAGGCCTCACCACTGCGTCGTGG
GAATCTAGCTCTCAGCTAAAGTTGCATACCGGCACGCCTGGCGATTTCGACACGCTGCACTTTATCCAAGGCGAC
GAGGGGGAATTGCGTGGAGACGAGGTGGAAATAAAAGTCCAGGCTTGGGCTGTCACTCGGCAAGATGTTGCAGTT
GCACAGGGTCGCGAGAATCAAGAGTTTGGGTTCGAGTGTGCCGGCATCGTCTCAAGACTGGGGCCTGAGTGTATC
TTGGGGCTTCAAGTTGGAGACCGCGTCGTCATGATTACGCCGGGGTGTATGAGGACGAATCCGCGCGCATCAGAA
CAGCTTGTGGCTAGGATTCCAGATAATGTGGCGATGAATGAGGTCGTCATCATGGTTGCGTCCGCGCTGACGCCT
TGTTATGCTTTGCTTGAGCTTGCTAGGCTTCAGGCGGGAGAGAGAGTCTTGGTTGACGATGCGGCGAGTGATGCG
GGTCAAATGGCCGTACGCATCGCGCTGGACCGAGGCGCCAAAGTCATGGCTACGGCTCAGACGAGTGAGGAGATG
GACTGGGTAGCCAGAGAGCTTGCCATTGCGTCAGACCATGTCTTGAGAGCAGGGACGTCGCTGGGGAAGCAAGTC
TCAAGGTTGACGAGTGGACAGGGAGTCGACATTGTTCTCAACTCTGGTGGAGCAGATGCTCTTGCATCGTTGCTC
GACTGCGTCGCTCCGCATGGCAAGGTGGTGGATCTGAACCGAGGAGATACAGGCTGGACAGCTCTCCTGGCACAA
TCGCGATTGGCGGCCAACATGACCCTGTCGTCTGTCAATGTCAGGGAACTGCTCAGGGCGAAACCAAGCCGTGTT
GGAGCCATTCTCAGGGATACACTCGATTTGGTGGCGCGGCAAGTCTTGAGCTGTCCTACGCCGCTTCATGTTTTT
CCCGTCTCGCAAGTCTGTCAGGCGTTTAAATCTGTCAATGCCAGCAACAAGACTGAAGCCGCAGTCATTGGCATC
GACCCTCTAGACACAGTCAAGGTACGCATTTCCCCCTTCAAACCCCCACACCCCAACGCTATACTCACAACCGTG
TATAGTGCGCTGTATCAACAAGTCCGTCTTGGAGGCTAG
Gene >OphauB2|1456
ATGCAAGCAGCAAGACGAGCGAGCCCCTTGTCAAGCCAGATATCTGGATTTTATATTCGGGAAGCTAGATTCAAG
AGCGCCATTCTTATAAGCGACGAGGCAGAGGATGCCAACGAGCTAGTGGTGCAGCTGCGGCCACTCGACAAGCTC
GGCTCTAGGGCGGCAACATGGTCAGAGGTTAGGATTTTTGCATACAGCCACTCAACATGTGCAGAATGTTTCCAA
TGCATCATTCGAACAGACCATGGTGAAGCAGCCGTCAACAAGGCCGACACTGATGAAAAAGAGCTCGAGGCTCGT
GAAATGCTGGGCGAGTATACAACGACACGGGAAAAATGTACTCACTACCTTGGCCCCAAGGCATTCTACAAGGAC
CTTGAGAGATTCAGCATTCGGTACAGTGGCTGTTTCAAGGCCCTGCAAGAGGCGTGGTGGAGTCCTAATGGGATA
GCCACTACTTGTCTTGAGGCCAAATCTCGACAGCACAGCACCACGAGCCTAGTCCATCCTGCGCTTCTGGATGCA
GTAATGCAGGCGATGCAAATAGGCAATGGACCAGAGGCTGTTTCCGGTGTGACGCCGACGCGCATGGCCGACGCA
TGGTTTGCTTCCACGGCGTGGCAGCAAATAGACACTGGCAGCATTCGATGCATCAAGCGCGCGAGCAAACGACCC
ACCGGAATTTTCAACCAGCAGAGCATTCATGCCGTGACGGATAGCGGATCCATCTTGTGTGCTATTAATGTATTG
GAGACGATGCAGAGGGAAGCAGTGGGCGGTGCTGGCGATTCGACAGAAGGCTTGCTACACAGGGTCGAGTGGAAG
CCGCAGCTTAGTCTGCTGAGTCCTGGAGAGCTGCGTCGGGTGTGTGATGCGGATAACATTGTGAGGGATGAGGTG
GGAATGGAAGAGGATAATGGAAAGCTGGATACAGTTTTGGGAAGAGTCTTGTGTGAGACGTTGGCGGAGATTTCG
AATGAGGGGGAGGAGAGGGTGAGGGGTCATTTGTCAAGGTATTTGGAGTGGATGAAGCACAAGGTTGGCCAAATT
GCACATGAAACGGGTCATGATGGCGAGGAGAGATTGCAAGAGGCACAAACAGTCGACGTCTGGCATGAAGAGTCG
GAAGACGGGTTCCAAAAAGTGGAAGCCTCTCAGGGCAGCTTGGCAGAGGGGATTTGTCATGAGAAGATGGAAAAC
GAGTTTCAGCAAGTCGAGGGCTCTCAGTTGAGCTTGGAAGAGGAGCCCCAACAGGTCGAGGTCTGTTATGAGGAG
ACCAAAGACGAATTGCCGCAAGTCCGAGTCTGCCGGAAGAGCTTTAAAGAGGAGCTACAAGCATTGCAAGCCTGT
AATGGCAAGATGAAAGACAAATTTCATCAGTGGAGCTTGGAAGAAGAGCTACATCAAGTCGAGGCCCTCAACCCA
GCTTGGAAACTCTACACCAGCCTGGCCCGCCAGCTCAAGTCGATCCTGCTTGGCGAAAGCAATGCACTCGACATC
ATGTACGGCACCGGCATGGCCGACGCGCTCTACCTCGACGTCTTCAAGCCCATCTGCGACGCCCGCCTATCAACA
CTGCTCGATCTCGTCTCGCACCAAAACCCCAACCTGCGCGTCCTCGAAGTCGGCGCCGGTACAGGTGGCCTCACC
TCTTTTATTCTCGGCTTTTTGCAAGACAAGGAGATGCAGACGGGCACAAGAGCCTTTTCCGAGTACACCTACACC
GACGTCTCGCCCAGCTTCTTTGACACGGCGAGCGACAAGTGGTCTGCGCTAAAGGACCGCATGGGATTCAAAGTC
TTTGATCTGGAACGCTCGGGAGCGTCGCAGGGCCTAGAACCGGGCTCGTATAACCTTGTTATCGCGGGTTGTGTG
CTTCATACGACGAGTAATCTCCCAGCCACGATTCAGGGCGTGCGCGACATGCTCAAGCCAAACGGTCGCTTGCTT
CTTGTTGAGCCGATTGCGCCAGAGAGTCTTGCGGCGGGTTTTCCGTGGGGGCTGCTGCCAGGCTGGTGGCGCGGA
GAAGAGGAGTGGCGGCGGCTGTCTGCTCTAGGCGATGAAGAGCGATGGGAGGCGCTTTTAAAGGAGAATGGCTTT
GGAGGGATTGATGTTTGTCTGCGAGACTATGCGAGTGAGGCGAATCGGCGCATTAGCGTCATGTTGACGACTGTC
GAGCCAGAGATTCGAGGCCAAGACGAGGGCAGCATTTACGTTGTTGTGGGAGACGAGGCAGTTGGGGAACAAGTT
GAGCTTGCCGAAGCGGTGCTGTCTCGTCGAGATCAGTTTGGGTGTGTGGATGGGGAAATGGTGCTGCTGAAAGAG
ATGCATACTCTGGAGACGTGCGACAACGACCTCGTCGTCTTTGTCGGCGAGATTGCCAAGCCGCTTCTGGGAGAC
ATGGACAGCGAAATACTGAACCATATCCGCGCCATGGTGGCCAAGGCGAAGCGGTTGTTTTGGGTGAATGCCACG
ACGGAGGGCGATGCCGCCATGCCGCACTTTTACCTTGCTCAAGGCCTACTGCGCTCTCTTCGCAGCGAGATGCCC
TCCACGCAAATAATTTCGCTAACAATTGAAGCACAAGACTTGAATCCCGAGTTTATTTTCAAGTATATTTCCACC
GTTGTCCACGACGTCTTTTGCTCCGACTCGGCAGAAGTGGAATTCATTGTGCGCAACGGCCAGCTGCTCACTGGG
CGCGCTGTGCAAGCCACTGTGGAGAGCAAGCATCTAGAGACTCTCATTTCGCCAGGCCTCACCACTGCGTCGTGG
GAATCTAGCTCTCAGCTAAAGTTGCATACCGGCACGCCTGGCGATTTCGACACGCTGCACTTTATCCAAGGCGAC
GAGGGGGAATTGCGTGGAGACGAGGTGGAAATAAAAGTCCAGGCTTGGGCTGTCACTCGGCAAGATGTTGCAGTT
GCACAGGGTCGCGAGAATCAAGAGTTTGGGTTCGAGTGTGCCGGCATCGTCTCAAGACTGGGGCCTGAGTGTATC
TTGGGGCTTCAAGTTGGAGACCGCGTCGTCATGATTACGCCGGGGTGTATGAGGACGAATCCGCGCGCATCAGAA
CAGCTTGTGGCTAGGATTCCAGATAATGTGGCGATGAATGAGGTCGTCATCATGGTTGCGTCCGCGCTGACGCCT
TGTTATGCTTTGCTTGAGCTTGCTAGGCTTCAGGCGGGAGAGAGAGTCTTGGTTGACGATGCGGCGAGTGATGCG
GGTCAAATGGCCGTACGCATCGCGCTGGACCGAGGCGCCAAAGTCATGGCTACGGCTCAGACGAGTGAGGAGATG
GACTGGGTAGCCAGAGAGCTTGCCATTGCGTCAGACCATGTCTTGAGAGCAGGGACGTCGCTGGGGAAGCAAGTC
TCAAGGTTGACGAGTGGACAGGGAGTCGACATTGTTCTCAACTCTGGTGGAGCAGATGCTCTTGCATCGTTGCTC
GACTGCGTCGCTCCGCATGGCAAGGTGGTGGATCTGAACCGAGGAGATACAGGCTGGACAGCTCTCCTGGCACAA
TCGCGATTGGCGGCCAACATGACCCTGTCGTCTGTCAATGTCAGGGAACTGCTCAGGGCGAAACCAAGCCGTGTT
GGAGCCATTCTCAGGGATACACTCGATTTGGTGGCGCGGCAAGTCTTGAGCTGTCCTACGCCGCTTCATGTTTTT
CCCGTCTCGCAAGTCTGTCAGGCGTTTAAATCTGTCAATGCCAGCAACAAGACTGAAGCCGCAGTCATTGGCATC
GACCCTCTAGACACAGTCAAGGTACGCATTTCCCCCTTCAAACCCCCACACCCCAACGCTATACTCACAACCGTG
TATAGTGCGCTGTATCAACAAGTCCGTCTTGGAGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail