Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1455
Gene name
LocationContig_14:26467..27962
Strand+
Gene length (bp)1495
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 1.9E-36 31 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 3 448 7.0E-64
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 21 449 4.0E-51
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 32 449 7.0E-46
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 32 449 4.0E-44
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 23 449 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 3 448 7.0E-64
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 21 449 4.0E-51
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 32 449 7.0E-46
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 32 449 4.0E-44
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 23 449 4.0E-43
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 8 448 3.0E-35
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 29 449 7.0E-33
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 29 449 9.0E-33
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 24 449 8.0E-32
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 29 398 5.0E-31
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 31 449 6.0E-31
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 31 449 7.0E-31
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 31 449 9.0E-31
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 24 449 1.0E-30
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 23 398 3.0E-30
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 31 449 2.0E-29
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 29 398 3.0E-29
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 8 448 3.0E-29
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 8 448 3.0E-29
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 8 448 4.0E-29
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 31 449 2.0E-28
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 29 449 4.0E-28
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 31 449 5.0E-28
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 32 448 9.0E-28
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 31 448 1.0E-27
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 32 448 1.0E-27
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 31 448 2.0E-27
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 32 448 2.0E-27
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 31 448 4.0E-27
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 32 448 4.0E-27
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 4 448 4.0E-27
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 29 398 5.0E-27
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 32 448 6.0E-27
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 32 448 1.0E-26
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 29 398 2.0E-26
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 32 448 2.0E-26
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 370 3.0E-26
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 29 449 3.0E-26
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 29 448 3.0E-26
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 370 4.0E-26
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 29 448 5.0E-26
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 23 413 4.0E-25
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 32 448 9.0E-25
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 32 339 9.0E-25
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 28 398 1.0E-24
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 32 339 1.0E-24
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 29 449 3.0E-24
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 31 449 7.0E-24
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 365 2.0E-23
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 32 339 6.0E-23
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 29 442 1.0E-22
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 29 400 2.0E-22
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 29 400 2.0E-22
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 29 400 2.0E-22
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 29 418 2.0E-22
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 29 366 2.0E-21
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 23 402 5.0E-21
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 30 399 8.0E-21
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 29 369 9.0E-21
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 31 449 5.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 22 397 6.0E-20
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 24 370 7.0E-20
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1 366 3.0E-19
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 29 449 3.0E-19
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 29 375 7.0E-19
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 31 321 2.0E-18
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 29 418 2.0E-18
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 28 317 9.0E-18
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 19 453 6.0E-17
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 19 453 6.0E-17
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 19 453 6.0E-17
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 19 453 6.0E-17
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 19 338 9.0E-17
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 28 329 1.0E-16
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 28 329 1.0E-16
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 28 329 1.0E-16
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 19 453 2.0E-16
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 22 392 3.0E-16
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 19 338 5.0E-16
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 19 338 8.0E-16
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 28 330 1.0E-15
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 29 320 2.0E-15
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 28 328 5.0E-15
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 28 328 5.0E-15
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 29 404 2.0E-14
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 28 283 1.0E-13
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 30 327 2.0E-12
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 29 298 2.0E-08
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 29 264 5.0E-08
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 29 320 5.0E-07
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 29 353 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1455
MPWRTFTLAHTTPSMAYAKPVRSASQLGLAFIFTGQGAHYVNMGIGLLAYPVFARTLRHIDKTLAGLGCTWSIFD
QLGSKTSLARPEYQHAISCAVQIALVELLRSFNVVASAVLGHSSGEVAAAYTIGALSLESACKVSYFRGQVSGRA
VDAGSDGAMLSANIAHDQVKAYVHRHLPAHLATAVSVACINSPLNSTLAGRNEAIDALKEKLDLDGVFAHKLDVG
LGYHSKQMHGLAPEYRALLGTLQGADSPQKGVPMISSVTGGVIDPARLATAEYWVDHLISPVRFSQAVTNLVQLD
ARHGSLAMTDLVEIGPHAALKRPLRDILDHGKHQIRYTPTLFRSKPALEAMLECAGTLHCYGYPVSVTAVNQQDA
SQEGMHVLVDCPEYPFDHSKKYWRESRLSCDYRLRATTDEMLGIPAHDWNPLEPRWRQFLSVEKMPWLAGHLVRF
LAANIA*
Coding >OphauB2|1455
ATGCCCTGGAGAACGTTTACCCTGGCGCACACGACGCCTTCAATGGCGTACGCCAAACCCGTCCGCTCAGCTAGT
CAGCTTGGCTTGGCATTCATCTTTACCGGCCAGGGAGCTCACTACGTCAACATGGGTATTGGCCTTTTGGCCTAC
CCAGTATTTGCAAGGACGCTACGGCACATTGACAAGACTCTTGCTGGCCTGGGTTGCACCTGGTCCATCTTTGAT
CAGCTTGGGAGCAAGACAAGTCTTGCCAGGCCAGAGTATCAGCATGCGATATCATGTGCTGTGCAGATTGCCTTG
GTTGAGCTGTTGCGAAGCTTTAATGTCGTTGCCAGTGCCGTTTTGGGCCACTCATCGGGCGAGGTGGCCGCTGCC
TACACCATTGGGGCCTTGTCGCTCGAGTCTGCATGCAAGGTGTCGTATTTTCGCGGACAGGTTTCAGGGAGGGCT
GTTGACGCTGGCTCCGACGGCGCTATGCTGTCGGCCAATATTGCCCATGACCAAGTCAAGGCCTATGTGCATCGA
CACCTGCCAGCACATCTTGCGACTGCCGTCTCTGTCGCATGTATCAACAGTCCGTTGAATAGCACGCTGGCTGGA
CGGAACGAAGCCATTGATGCTCTCAAGGAGAAGCTTGATTTGGATGGTGTTTTTGCACATAAGCTTGATGTTGGT
CTTGGCTATCACTCAAAACAGATGCATGGACTGGCACCAGAATATCGTGCTCTCCTAGGAACGCTTCAAGGAGCC
GACTCACCACAAAAGGGTGTGCCAATGATATCATCGGTTACAGGTGGCGTCATTGACCCGGCTCGCTTGGCGACA
GCAGAGTACTGGGTGGACCACTTGATTTCACCCGTTAGATTCTCTCAAGCCGTGACGAATCTTGTTCAACTAGAT
GCAAGACATGGCTCTTTGGCCATGACGGACCTCGTTGAAATTGGTCCCCACGCTGCTTTGAAGAGGCCGCTTCGA
GACATATTGGACCATGGCAAACATCAAATACGATATACTCCCACTTTGTTTCGATCCAAGCCCGCTCTGGAAGCC
ATGTTGGAGTGCGCTGGGACTCTGCACTGCTACGGATATCCCGTTTCCGTCACTGCTGTGAACCAGCAAGACGCG
TCGCAAGAGGGGATGCATGTTCTCGTTGACTGTCCCGAGTATCCATTTGATCACTCCAAGAAATATTGGCGCGAA
TCCCGCTTAAGCTGCGATTACAGGCTAAGAGCTACGACGGACGAGATGCTGGGGATCCCGGCGCATGACTGGAAT
CCCCTGGAGCCACGCTGGAGGCAGTTCCTGAGCGTTGAAAAGATGCCGTGGCTTGCGGGCCACTTGGTACGCTTC
CTCGCGGCAAACATTGCTTGA
Transcript >OphauB2|1455
ATGCCCTGGAGAACGTTTACCCTGGCGCACACGACGCCTTCAATGGCGTACGCCAAACCCGTCCGCTCAGCTAGT
CAGCTTGGCTTGGCATTCATCTTTACCGGCCAGGGAGCTCACTACGTCAACATGGGTATTGGCCTTTTGGCCTAC
CCAGTATTTGCAAGGACGCTACGGCACATTGACAAGACTCTTGCTGGCCTGGGTTGCACCTGGTCCATCTTTGAT
CAGCTTGGGAGCAAGACAAGTCTTGCCAGGCCAGAGTATCAGCATGCGATATCATGTGCTGTGCAGATTGCCTTG
GTTGAGCTGTTGCGAAGCTTTAATGTCGTTGCCAGTGCCGTTTTGGGCCACTCATCGGGCGAGGTGGCCGCTGCC
TACACCATTGGGGCCTTGTCGCTCGAGTCTGCATGCAAGGTGTCGTATTTTCGCGGACAGGTTTCAGGGAGGGCT
GTTGACGCTGGCTCCGACGGCGCTATGCTGTCGGCCAATATTGCCCATGACCAAGTCAAGGCCTATGTGCATCGA
CACCTGCCAGCACATCTTGCGACTGCCGTCTCTGTCGCATGTATCAACAGTCCGTTGAATAGCACGCTGGCTGGA
CGGAACGAAGCCATTGATGCTCTCAAGGAGAAGCTTGATTTGGATGGTGTTTTTGCACATAAGCTTGATGTTGGT
CTTGGCTATCACTCAAAACAGATGCATGGACTGGCACCAGAATATCGTGCTCTCCTAGGAACGCTTCAAGGAGCC
GACTCACCACAAAAGGGTGTGCCAATGATATCATCGGTTACAGGTGGCGTCATTGACCCGGCTCGCTTGGCGACA
GCAGAGTACTGGGTGGACCACTTGATTTCACCCGTTAGATTCTCTCAAGCCGTGACGAATCTTGTTCAACTAGAT
GCAAGACATGGCTCTTTGGCCATGACGGACCTCGTTGAAATTGGTCCCCACGCTGCTTTGAAGAGGCCGCTTCGA
GACATATTGGACCATGGCAAACATCAAATACGATATACTCCCACTTTGTTTCGATCCAAGCCCGCTCTGGAAGCC
ATGTTGGAGTGCGCTGGGACTCTGCACTGCTACGGATATCCCGTTTCCGTCACTGCTGTGAACCAGCAAGACGCG
TCGCAAGAGGGGATGCATGTTCTCGTTGACTGTCCCGAGTATCCATTTGATCACTCCAAGAAATATTGGCGCGAA
TCCCGCTTAAGCTGCGATTACAGGCTAAGAGCTACGACGGACGAGATGCTGGGGATCCCGGCGCATGACTGGAAT
CCCCTGGAGCCACGCTGGAGGCAGTTCCTGAGCGTTGAAAAGATGCCGTGGCTTGCGGGCCACTTGGTACGCTTC
CTCGCGGCAAACATTGCTTGA
Gene >OphauB2|1455
ATGCCCTGGAGAACGTTTACCCTGGCGCACACGACGCCTTCAATGGCGTACGCCAAACCCGTCCGCTCAGCTAGT
CAGCTTGGCTTGGCATTCATCTTTACCGGCCAGGGAGCTCACTACGTCAACATGGGTATTGGCCTTTTGGCCTAC
CCAGTATTTGCAAGGACGCTACGGCACATTGACAAGACTCTTGCTGGCCTGGGTTGCACCTGGTCCATCTTTGGT
GAGAGGCTATTGCGTATGGCACTATGATTATATCACGGACGCTGACAAAATGAATGACGGCTTAGATCAGCTTGG
GAGCAAGACAAGTCTTGCCAGGCCAGAGTATCAGCATGCGATATCATGTGCTGTGCAGATTGCCTTGGTTGAGCT
GTTGCGAAGCTTTAATGTCGTTGCCAGTGCCGTTTTGGGCCACTCATCGGGCGAGGTGGCCGCTGCGTATGCACG
CTTTTGCTATACCTGATGGAAAGCTTGTAAACTAACCCACTGTATCAGCTACACCATTGGGGCCTTGTCGCTCGA
GTCTGCATGCAAGGTGTCGTATTTTCGCGGACAGGTTTCAGGGAGGGCTGTTGACGCTGGCTCCGACGGCGCTAT
GCTGTCGGCCAATATTGCCCATGACCAAGTCAAGGCCTATGTGCATCGACACCTGCCAGCACATCTTGCGACTGC
CGTCTCTGTCGCATGTATCAACAGTCCGTTGAATAGCACGCTGGCTGGACGGAACGAAGCCATTGATGCTCTCAA
GGAGAAGCTTGATTTGGATGGTGTTTTTGCACATAAGCTTGATGTTGGTCTTGGCTATCACTCAAAACAGATGCA
TGGACTGGCACCAGAATATCGTGCTCTCCTAGGAACGCTTCAAGGAGCCGACTCACCACAAAAGGGTGTGCCAAT
GATATCATCGGTTACAGGTGGCGTCATTGACCCGGCTCGCTTGGCGACAGCAGAGTACTGGGTGGACCACTTGAT
TTCACCCGTTAGATTCTCTCAAGCCGTGACGAATCTTGTTCAACTAGATGCAAGACATGGCTCTTTGGCCATGAC
GGACCTCGTTGAAATTGGTCCCCACGCTGCTTTGAAGAGGCCGCTTCGAGACATATTGGACCATGGCAAACATCA
AATACGATATACTCCCACTTTGTTTCGATCCAAGCCCGCTCTGGAAGCCATGTTGGAGTGCGCTGGGACTCTGCA
CTGCTACGGATATCCCGTTTCCGTCACTGCTGTGAACCAGCAAGACGCGTCGCAAGAGGGGATGCATGTTCTCGT
TGACTGTCCCGAGTATCCATTTGATCACTCCAAGAAATATTGGCGCGAATCCCGCTTAAGCTGCGATTACAGGCT
AAGAGCTACGACGGACGAGATGCTGGGGATCCCGGCGCATGACTGGAATCCCCTGGAGCCACGCTGGAGGCAGTT
CCTGAGCGTTGAAAAGATGCCGTGGCTTGCGGGCCACTTGGTACGCTTCCTCGCGGCAAACATTGCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail