Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1452
Gene name
LocationContig_14:21041..21518
Strand+
Gene length (bp)477
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00043 GST_C Glutathione S-transferase, C-terminal domain 1.5E-11 14 95
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 1.4E-08 25 89
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 2.4E-05 33 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 2 95 3.0E-20
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 110 5.0E-14
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 2 111 3.0E-10
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 2 111 8.0E-10
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 2 158 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 2 95 3.0E-20
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 2 110 5.0E-14
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 2 111 3.0E-10
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 2 111 8.0E-10
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 2 158 2.0E-09
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 2 158 2.0E-09
sp|Q29387|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2 2 158 2.0E-09
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 2 158 3.0E-09
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 8 111 6.0E-09
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 2 158 7.0E-09
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 2 158 8.0E-09
sp|Q3SZV3|EF1G_BOVIN Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1 2 111 1.0E-08
sp|Q91375|EF1GB_XENLA Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-b PE=2 SV=1 8 111 2.0E-08
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 2 158 2.0E-08
sp|P42936|YG4D_YEAST Putative elongation factor 1 gamma homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR201C PE=4 SV=3 11 108 2.0E-08
sp|P12261|EF1G_ARTSA Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3 2 109 5.0E-08
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 13 109 1.0E-07
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 1 97 1.0E-07
sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 1 97 3.0E-07
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 2 97 5.0E-07
sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 1 97 6.0E-07
sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 2 119 1.0E-06
sp|P54412|EF1G_CAEEL Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=eef-1G PE=3 SV=1 9 96 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1452
MEIAVQLTGWFQPLVGWREYNKASVDKSSQAALKAVNIVETHLSNRAFLVGETLSAADYVCAGLVYRGFQYFFDR
NWRQHHPNVSQWYEVVTSQPAYLATTEKLQLLEQPALVNKPPSETTIRINRLRLSKTSKVNSRYILMLRKRDSGR
ARNAKKRD*
Coding >OphauB2|1452
ATGGAAATCGCTGTCCAGTTAACAGGTTGGTTCCAGCCTCTTGTGGGTTGGAGAGAATACAACAAGGCATCTGTA
GACAAGAGTTCCCAAGCAGCACTCAAGGCGGTCAATATTGTCGAGACACATTTGAGCAACAGAGCCTTTTTAGTT
GGCGAGACTCTTAGTGCTGCCGATTACGTTTGCGCCGGCCTTGTGTATCGCGGCTTCCAGTACTTTTTTGATAGA
AATTGGCGCCAACATCATCCAAACGTTAGCCAATGGTACGAAGTTGTCACGAGTCAACCGGCTTACCTCGCCACT
ACGGAAAAGCTCCAATTACTTGAGCAGCCTGCTCTAGTAAATAAACCTCCCTCTGAGACAACGATTCGAATTAAT
CGCCTGCGTCTGAGCAAAACGTCCAAGGTAAATTCCCGCTATATCCTCATGTTGCGCAAAAGAGATTCGGGCCGA
GCCCGAAATGCTAAAAAGCGTGACTGA
Transcript >OphauB2|1452
ATGGAAATCGCTGTCCAGTTAACAGGTTGGTTCCAGCCTCTTGTGGGTTGGAGAGAATACAACAAGGCATCTGTA
GACAAGAGTTCCCAAGCAGCACTCAAGGCGGTCAATATTGTCGAGACACATTTGAGCAACAGAGCCTTTTTAGTT
GGCGAGACTCTTAGTGCTGCCGATTACGTTTGCGCCGGCCTTGTGTATCGCGGCTTCCAGTACTTTTTTGATAGA
AATTGGCGCCAACATCATCCAAACGTTAGCCAATGGTACGAAGTTGTCACGAGTCAACCGGCTTACCTCGCCACT
ACGGAAAAGCTCCAATTACTTGAGCAGCCTGCTCTAGTAAATAAACCTCCCTCTGAGACAACGATTCGAATTAAT
CGCCTGCGTCTGAGCAAAACGTCCAAGGTAAATTCCCGCTATATCCTCATGTTGCGCAAAAGAGATTCGGGCCGA
GCCCGAAATGCTAAAAAGCGTGACTGA
Gene >OphauB2|1452
ATGGAAATCGCTGTCCAGTTAACAGGTTGGTTCCAGCCTCTTGTGGGTTGGAGAGAATACAACAAGGCATCTGTA
GACAAGAGTTCCCAAGCAGCACTCAAGGCGGTCAATATTGTCGAGACACATTTGAGCAACAGAGCCTTTTTAGTT
GGCGAGACTCTTAGTGCTGCCGATTACGTTTGCGCCGGCCTTGTGTATCGCGGCTTCCAGTACTTTTTTGATAGA
AATTGGCGCCAACATCATCCAAACGTTAGCCAATGGTACGAAGTTGTCACGAGTCAACCGGCTTACCTCGCCACT
ACGGAAAAGCTCCAATTACTTGAGCAGCCTGCTCTAGTAAATAAACCTCCCTCTGAGACAACGATTCGAATTAAT
CGCCTGCGTCTGAGCAAAACGTCCAAGGTAAATTCCCGCTATATCCTCATGTTGCGCAAAAGAGATTCGGGCCGA
GCCCGAAATGCTAAAAAGCGTGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail