Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|144
Gene name
LocationContig_1:366111..366568
Strand+
Gene length (bp)457
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 1.7E-06 39 93

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup811
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5089
Ophiocordyceps australis map64 (Brazil) OphauB2|144 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2380
Ophiocordyceps camponoti-floridani Ophcf2|00020
Ophiocordyceps camponoti-rufipedis Ophun1|2813
Ophiocordyceps kimflemingae Ophio5|4078
Ophiocordyceps subramaniannii Hirsu2|3739
Ophiocordyceps subramaniannii Hirsu2|6049

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|144
MHSQKLIKTACVLASGYSTQAQDLAITKVKIIDVASGTTLQAATVNAAQLLGTEESMGALGVGKLADVVLLRGNP
LDQMSSVRQIEAVVADGQLFERERLHEMLKISTKPAQCGKSAREKRHEGAIPLPSYCSRH*
Coding >OphauB2|144
ATGCATTCACAAAAACTAATCAAAACAGCTTGCGTCCTAGCATCAGGCTATTCAACGCAGGCCCAAGACTTGGCC
ATTACAAAGGTCAAAATCATCGACGTGGCCAGCGGCACCACGCTGCAGGCGGCAACGGTGAATGCCGCCCAGCTG
CTCGGCACCGAGGAGAGCATGGGGGCGCTGGGCGTGGGCAAGCTGGCCGATGTGGTGCTGCTGAGGGGAAACCCG
TTGGACCAGATGAGCAGTGTGCGTCAGATTGAGGCCGTGGTGGCGGATGGGCAGTTGTTTGAGCGGGAGAGGCTG
CATGAGATGCTAAAGATTTCTACCAAGCCGGCGCAGTGTGGCAAGAGTGCTAGGGAGAAGCGCCACGAGGGGGCG
ATTCCTCTGCCCAGCTATTGTTCTCGACACTAG
Transcript >OphauB2|144
ATGCATTCACAAAAACTAATCAAAACAGCTTGCGTCCTAGCATCAGGCTATTCAACGCAGGCCCAAGACTTGGCC
ATTACAAAGGTCAAAATCATCGACGTGGCCAGCGGCACCACGCTGCAGGCGGCAACGGTGAATGCCGCCCAGCTG
CTCGGCACCGAGGAGAGCATGGGGGCGCTGGGCGTGGGCAAGCTGGCCGATGTGGTGCTGCTGAGGGGAAACCCG
TTGGACCAGATGAGCAGTGTGCGTCAGATTGAGGCCGTGGTGGCGGATGGGCAGTTGTTTGAGCGGGAGAGGCTG
CATGAGATGCTAAAGATTTCTACCAAGCCGGCGCAGTGTGGCAAGAGTGCTAGGGAGAAGCGCCACGAGGGGGCG
ATTCCTCTGCCCAGCTATTGTTCTCGACACTAG
Gene >OphauB2|144
ATGCATTCACAAAAACTAATCAAAACAGCTTGCGTCCTAGCATCAGGCTATTCAACGCAGGCCCAAGACTTGGCC
ATTACAAAGGTCAAAATCATCGACGTGGCCAGCGGCACCGTCCAGAAGCCCCAAGACATCATCAGAGGCTGGTCT
GACGCCGCTCCAGACGCTGCAGGCGGCAACGGTGAATGCCGCCCAGCTGCTCGGCACCGAGGAGAGCATGGGGGC
GCTGGGCGTGGGCAAGCTGGCCGATGTGGTGCTGCTGAGGGGAAACCCGTTGGACCAGATGAGCAGTGTGCGTCA
GATTGAGGCCGTGGTGGCGGATGGGCAGTTGTTTGAGCGGGAGAGGCTGCATGAGATGCTAAAGATTTCTACCAA
GCCGGCGCAGTGTGGCAAGAGTGCTAGGGAGAAGCGCCACGAGGGGGCGATTCCTCTGCCCAGCTATTGTTCTCG
ACACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail