Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1437
Gene name
LocationContig_139:19747..21192
Strand+
Gene length (bp)1445
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.2E-09 31 96
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.1E-14 124 194
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.4E-16 259 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 28 367 2.0E-117
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 30 329 2.0E-81
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 30 331 3.0E-81
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 14 360 1.0E-79
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 30 387 9.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 28 367 2.0E-117
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 30 329 2.0E-81
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 30 331 3.0E-81
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 14 360 1.0E-79
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 30 387 9.0E-78
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 5 327 1.0E-77
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 30 331 4.0E-77
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 30 362 4.0E-76
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 21 331 1.0E-75
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 30 332 5.0E-75
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 30 329 5.0E-73
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 17 329 7.0E-71
sp|Q00539|NAM8_YEAST Protein NAM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM8 PE=1 SV=2 31 329 9.0E-71
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 70 328 2.0E-58
sp|Q4KM14|TSP1L_DANRE tRNA selenocysteine 1-associated protein 1-like OS=Danio rerio GN=trnau1apl PE=2 SV=1 29 244 2.0E-44
sp|Q9NX07|TSAP1_HUMAN tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens GN=TRNAU1AP PE=1 SV=1 30 202 5.0E-44
sp|Q1RMJ7|TSAP1_BOVIN tRNA selenocysteine 1-associated protein 1 OS=Bos taurus GN=TRNAU1AP PE=2 SV=1 30 202 6.0E-44
sp|Q9QZI7|TSAP1_RAT tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus GN=Trnau1ap PE=1 SV=1 30 202 1.0E-43
sp|Q5R462|TSAP1_PONAB tRNA selenocysteine 1-associated protein 1 OS=Pongo abelii GN=TRNAU1AP PE=2 SV=1 30 202 2.0E-43
sp|Q80VC6|TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus GN=Trnau1ap PE=1 SV=2 30 202 2.0E-43
sp|O94621|US109_SCHPO U1 snRNP-associated protein usp109 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp109 PE=1 SV=2 29 376 1.0E-37
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 12 332 2.0E-35
sp|Q503H1|TSAP1_DANRE tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1 30 230 2.0E-30
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 16 327 3.0E-30
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 30 327 7.0E-30
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 30 328 2.0E-28
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 25 328 3.0E-28
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 30 345 8.0E-28
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 25 328 3.0E-27
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 30 328 1.0E-26
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 16 327 3.0E-26
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 24 340 4.0E-19
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 2 333 2.0E-18
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 5 332 3.0E-17
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 4 332 4.0E-17
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 22 334 9.0E-17
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 4 326 1.0E-16
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 4 332 1.0E-16
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 22 334 2.0E-16
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 9 332 3.0E-16
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 29 203 3.0E-16
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 9 334 3.0E-16
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 28 326 3.0E-16
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 29 231 4.0E-16
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 29 231 4.0E-16
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 5 332 4.0E-16
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 22 334 4.0E-16
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 22 334 5.0E-16
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 18 332 5.0E-16
sp|Q66KL9|RBM42_XENTR RNA-binding protein 42 OS=Xenopus tropicalis GN=rbm42 PE=2 SV=1 104 204 6.0E-16
sp|Q6DRG1|RBM42_DANRE RNA-binding protein 42 OS=Danio rerio GN=rbm42 PE=2 SV=2 103 204 6.0E-16
sp|Q0P5L0|RBM42_BOVIN RNA-binding protein 42 OS=Bos taurus GN=RBM42 PE=2 SV=1 121 204 1.0E-15
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 4 326 1.0E-15
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 4 326 1.0E-15
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 31 339 1.0E-15
sp|Q9BTD8|RBM42_HUMAN RNA-binding protein 42 OS=Homo sapiens GN=RBM42 PE=1 SV=1 121 204 1.0E-15
sp|Q6AXT7|RBM42_RAT RNA-binding protein 42 OS=Rattus norvegicus GN=Rbm42 PE=1 SV=1 121 204 2.0E-15
sp|Q91V81|RBM42_MOUSE RNA-binding protein 42 OS=Mus musculus GN=Rbm42 PE=1 SV=1 121 204 2.0E-15
sp|A2VDB3|RBM42_XENLA RNA-binding protein 42 OS=Xenopus laevis GN=rbm42 PE=2 SV=1 104 205 3.0E-15
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 28 326 3.0E-15
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 17 326 4.0E-15
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 4 326 4.0E-15
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 29 330 5.0E-15
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 31 386 6.0E-15
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 17 326 7.0E-15
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 31 330 1.0E-14
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 29 330 1.0E-14
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 31 330 1.0E-14
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 31 330 1.0E-14
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 31 330 1.0E-14
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 31 330 1.0E-14
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 31 330 1.0E-14
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 17 326 2.0E-14
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 25 332 3.0E-14
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 13 334 3.0E-14
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 29 314 4.0E-14
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 31 337 5.0E-14
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 7 332 1.0E-13
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 29 203 2.0E-13
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 2 330 2.0E-13
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 5 340 2.0E-13
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 26 330 4.0E-13
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 12 312 2.0E-12
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 31 288 4.0E-12
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 29 333 4.0E-12
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 27 340 4.0E-12
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 25 330 5.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 49 203 5.0E-12
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 27 340 5.0E-12
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 27 340 5.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 49 203 5.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 49 203 5.0E-12
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 123 326 5.0E-12
sp|Q6P616|RBM22_XENTR Pre-mRNA-splicing factor RBM22 OS=Xenopus tropicalis GN=rbm22 PE=2 SV=1 253 334 6.0E-12
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 27 340 6.0E-12
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 30 329 7.0E-12
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 25 331 7.0E-12
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 29 340 8.0E-12
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 27 340 9.0E-12
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 28 332 9.0E-12
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 27 331 9.0E-12
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 28 326 9.0E-12
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 21 326 9.0E-12
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 19 203 1.0E-11
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 1 332 1.0E-11
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 18 314 1.0E-11
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 30 384 1.0E-11
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 10 204 1.0E-11
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 31 288 2.0E-11
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 49 202 2.0E-11
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 28 332 2.0E-11
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 30 333 2.0E-11
sp|Q6NZZ9|RBM22_DANRE Pre-mRNA-splicing factor RBM22 OS=Danio rerio GN=rbm22 PE=2 SV=1 253 336 2.0E-11
sp|Q3B7L8|RBM22_BOVIN Pre-mRNA-splicing factor RBM22 OS=Bos taurus GN=RBM22 PE=2 SV=1 253 334 3.0E-11
sp|Q4V7D7|RBM22_RAT Pre-mRNA-splicing factor RBM22 OS=Rattus norvegicus GN=Rbm22 PE=2 SV=1 253 334 3.0E-11
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 28 332 3.0E-11
sp|Q5ZM16|RBM22_CHICK Pre-mRNA-splicing factor RBM22 OS=Gallus gallus GN=RBM22 PE=2 SV=1 253 334 3.0E-11
sp|Q8BHS3|RBM22_MOUSE Pre-mRNA-splicing factor RBM22 OS=Mus musculus GN=Rbm22 PE=1 SV=1 253 334 4.0E-11
sp|Q4R4J1|RBM22_MACFA Pre-mRNA-splicing factor RBM22 OS=Macaca fascicularis GN=RBM22 PE=2 SV=1 253 334 4.0E-11
sp|Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens GN=RBM22 PE=1 SV=1 253 334 4.0E-11
sp|Q5RAY5|RBM22_PONAB Pre-mRNA-splicing factor RBM22 OS=Pongo abelii GN=RBM22 PE=2 SV=1 253 334 4.0E-11
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 28 334 7.0E-11
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 30 317 7.0E-11
sp|Q7ZXB5|RBM22_XENLA Pre-mRNA-splicing factor RBM22 OS=Xenopus laevis GN=rbm22 PE=2 SV=1 253 334 1.0E-10
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 27 340 2.0E-10
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 31 288 4.0E-10
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 26 362 4.0E-10
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 31 288 5.0E-10
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 31 288 6.0E-10
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 30 202 6.0E-10
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 19 203 7.0E-10
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 12 330 7.0E-10
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 115 322 9.0E-10
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 27 314 9.0E-10
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 29 333 9.0E-10
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 29 333 9.0E-10
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 31 288 1.0E-09
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 31 288 1.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 40 199 1.0E-09
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 27 332 1.0E-09
sp|Q9LNV5|C3H4_ARATH Zinc finger CCCH domain-containing protein 4 OS=Arabidopsis thaliana GN=At1g07360 PE=2 SV=1 171 328 1.0E-09
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 30 330 1.0E-09
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 31 330 1.0E-09
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 120 325 2.0E-09
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 122 200 2.0E-09
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 31 202 2.0E-09
sp|Q9ZW36|C3H25_ARATH Zinc finger CCCH domain-containing protein 25 OS=Arabidopsis thaliana GN=At2g29580 PE=2 SV=1 253 330 2.0E-09
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 31 288 3.0E-09
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 19 203 3.0E-09
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 120 325 3.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 27 332 3.0E-09
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 30 199 3.0E-09
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 19 203 4.0E-09
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 19 203 4.0E-09
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 19 203 5.0E-09
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 19 203 6.0E-09
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 18 202 6.0E-09
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 103 312 6.0E-09
sp|Q9UPN6|SCAF8_HUMAN Protein SCAF8 OS=Homo sapiens GN=SCAF8 PE=1 SV=1 256 340 6.0E-09
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 29 204 1.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 29 204 1.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 29 204 1.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 29 204 1.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 29 204 1.0E-08
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 29 202 1.0E-08
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 19 203 1.0E-08
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 35 203 1.0E-08
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 35 203 1.0E-08
sp|Q6DID3|SCAF8_MOUSE Protein SCAF8 OS=Mus musculus GN=Scaf8 PE=1 SV=1 256 340 1.0E-08
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 116 312 1.0E-08
sp|Q63623|SCAF8_RAT Protein SCAF8 OS=Rattus norvegicus GN=Scaf8 PE=1 SV=1 256 340 1.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 29 204 2.0E-08
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 40 203 2.0E-08
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 24 206 2.0E-08
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 29 203 3.0E-08
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 24 214 3.0E-08
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 19 203 4.0E-08
sp|Q5SNN4|C3H40_ORYSJ Zinc finger CCCH domain-containing protein 40 OS=Oryza sativa subsp. japonica GN=Os06g0170500 PE=2 SV=1 171 330 4.0E-08
sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 253 330 4.0E-08
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 22 202 5.0E-08
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 22 202 8.0E-08
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 124 202 8.0E-08
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 30 202 8.0E-08
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 33 330 9.0E-08
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 33 330 9.0E-08
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 33 330 9.0E-08
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 33 330 9.0E-08
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 33 330 9.0E-08
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 33 330 9.0E-08
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 29 243 9.0E-08
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 29 214 1.0E-07
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 123 312 1.0E-07
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 26 202 2.0E-07
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 22 203 2.0E-07
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 6 204 2.0E-07
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 30 192 2.0E-07
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 30 192 2.0E-07
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 30 192 2.0E-07
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 26 222 3.0E-07
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 29 234 3.0E-07
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 26 347 3.0E-07
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 30 194 3.0E-07
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 30 192 3.0E-07
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 123 338 4.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 256 320 4.0E-07
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 28 208 5.0E-07
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 13 202 6.0E-07
sp|P16914|ELAV_DROME Protein elav OS=Drosophila melanogaster GN=elav PE=2 SV=1 119 204 7.0E-07
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 31 204 8.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 111 202 8.0E-07
sp|P23241|ELAV_DROVI Protein elav OS=Drosophila virilis GN=elav PE=3 SV=1 119 204 9.0E-07
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 27 197 1.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 29 238 1.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 31 204 1.0E-06
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 30 192 1.0E-06
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 31 252 1.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 119 325 1.0E-06
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 31 202 1.0E-06
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 49 230 1.0E-06
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 29 238 2.0E-06
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 29 187 2.0E-06
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 119 325 2.0E-06
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 49 327 2.0E-06
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 124 324 2.0E-06
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 31 206 2.0E-06
sp|Q9NEW6|RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans GN=rsp-3 PE=1 SV=2 255 326 2.0E-06
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 121 199 3.0E-06
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 28 192 3.0E-06
sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 18 190 5.0E-06
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 31 204 5.0E-06
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 121 199 7.0E-06
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 123 202 8.0E-06
sp|Q7TN33|CELF6_MOUSE CUGBP Elav-like family member 6 OS=Mus musculus GN=Celf6 PE=2 SV=1 13 237 8.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 71 202 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1437
MSFANGTPPATDMSAVPPAPGGAQEPPKTTLWMGELEPWMDENFIKGVFLSSAGENVNVKVIRDKNSGNAGYCFV
EFTTPDAATKALNLNGSPVPNSSRQFKLNWASGGGLVDRRDDRGPEYSIFVGDLGPEVNEYVLVSLFQARFPSCK
SAKIMTDAMSGQSRGYGFVRFSDENDQQRALVEMQGVYCGNRPMRISTATPKNRGNHGFAGHGHHAGGPMMGGGM
PPQQMWGQVGGFPYGGYNPATQMNQFTDPNNTTVFVGGLSGYVTEDELRSFFQGFGEITYVKIPPGKGCGFVQFV
HRHAAEMAINQMQGYPIGNSRVRLSWGRSQNNSGVGTPYRPAPPPPHYMGMPGHGPGPYGPQHFGGPGSAMPGPP
GPPGPPGPGGPQ*
Coding >OphauB2|1437
ATGAGTTTCGCCAACGGTACGCCTCCCGCGACGGACATGTCGGCTGTTCCACCAGCCCCTGGTGGCGCCCAGGAG
CCCCCTAAGACGACGCTCTGGATGGGCGAATTGGAGCCTTGGATGGACGAAAACTTTATCAAGGGCGTCTTTCTT
TCATCAGCTGGTGAAAATGTCAACGTCAAGGTTATTCGTGACAAGAACTCGGGTAATGCTGGCTACTGCTTTGTC
GAGTTTACCACTCCCGATGCCGCCACCAAAGCCTTGAACCTAAATGGGTCTCCGGTTCCGAACTCCTCGCGCCAA
TTCAAGCTCAACTGGGCTTCTGGTGGCGGCCTTGTTGACCGACGCGATGATCGTGGCCCCGAATACAGCATCTTT
GTGGGCGATCTGGGTCCTGAGGTTAACGAATACGTTTTGGTTTCTCTGTTCCAAGCTCGCTTCCCGTCTTGCAAG
TCTGCCAAAATCATGACGGACGCCATGTCGGGCCAGAGTCGTGGCTACGGATTCGTTCGCTTCTCAGACGAAAAC
GACCAGCAGCGCGCCCTGGTGGAAATGCAGGGCGTGTACTGTGGCAACAGGCCTATGAGAATCTCCACGGCCACA
CCTAAGAATCGTGGCAATCATGGTTTTGCAGGGCACGGTCACCATGCCGGCGGTCCCATGATGGGAGGCGGTATG
CCTCCTCAGCAGATGTGGGGACAAGTAGGGGGATTCCCGTACGGTGGATATAATCCAGCCACGCAGATGAACCAG
TTTACGGACCCAAACAACACGACGGTCTTTGTCGGTGGTCTTTCCGGCTATGTGACCGAGGACGAGCTCCGATCA
TTCTTCCAGGGATTTGGTGAAATCACCTATGTCAAGATTCCCCCCGGCAAGGGCTGTGGTTTTGTTCAGTTTGTC
CACCGCCATGCTGCCGAGATGGCCATCAACCAAATGCAGGGTTATCCCATTGGCAATTCTCGTGTCCGCCTTAGC
TGGGGACGTTCTCAGAACAACTCTGGTGTGGGTACTCCTTATCGCCCTGCACCCCCTCCCCCTCATTACATGGGA
ATGCCTGGCCATGGCCCTGGACCATATGGTCCGCAGCACTTTGGGGGCCCAGGCTCTGCTATGCCCGGTCCACCA
GGTCCTCCTGGCCCTCCTGGTCCAGGTGGTCCCCAGTAA
Transcript >OphauB2|1437
ATGAGTTTCGCCAACGGTACGCCTCCCGCGACGGACATGTCGGCTGTTCCACCAGCCCCTGGTGGCGCCCAGGAG
CCCCCTAAGACGACGCTCTGGATGGGCGAATTGGAGCCTTGGATGGACGAAAACTTTATCAAGGGCGTCTTTCTT
TCATCAGCTGGTGAAAATGTCAACGTCAAGGTTATTCGTGACAAGAACTCGGGTAATGCTGGCTACTGCTTTGTC
GAGTTTACCACTCCCGATGCCGCCACCAAAGCCTTGAACCTAAATGGGTCTCCGGTTCCGAACTCCTCGCGCCAA
TTCAAGCTCAACTGGGCTTCTGGTGGCGGCCTTGTTGACCGACGCGATGATCGTGGCCCCGAATACAGCATCTTT
GTGGGCGATCTGGGTCCTGAGGTTAACGAATACGTTTTGGTTTCTCTGTTCCAAGCTCGCTTCCCGTCTTGCAAG
TCTGCCAAAATCATGACGGACGCCATGTCGGGCCAGAGTCGTGGCTACGGATTCGTTCGCTTCTCAGACGAAAAC
GACCAGCAGCGCGCCCTGGTGGAAATGCAGGGCGTGTACTGTGGCAACAGGCCTATGAGAATCTCCACGGCCACA
CCTAAGAATCGTGGCAATCATGGTTTTGCAGGGCACGGTCACCATGCCGGCGGTCCCATGATGGGAGGCGGTATG
CCTCCTCAGCAGATGTGGGGACAAGTAGGGGGATTCCCGTACGGTGGATATAATCCAGCCACGCAGATGAACCAG
TTTACGGACCCAAACAACACGACGGTCTTTGTCGGTGGTCTTTCCGGCTATGTGACCGAGGACGAGCTCCGATCA
TTCTTCCAGGGATTTGGTGAAATCACCTATGTCAAGATTCCCCCCGGCAAGGGCTGTGGTTTTGTTCAGTTTGTC
CACCGCCATGCTGCCGAGATGGCCATCAACCAAATGCAGGGTTATCCCATTGGCAATTCTCGTGTCCGCCTTAGC
TGGGGACGTTCTCAGAACAACTCTGGTGTGGGTACTCCTTATCGCCCTGCACCCCCTCCCCCTCATTACATGGGA
ATGCCTGGCCATGGCCCTGGACCATATGGTCCGCAGCACTTTGGGGGCCCAGGCTCTGCTATGCCCGGTCCACCA
GGTCCTCCTGGCCCTCCTGGTCCAGGTGGTCCCCAGTAA
Gene >OphauB2|1437
ATGAGTTTCGCCAACGGTACGCCTCCCGCGACGGACATGTCGGCTGTTCCACCAGCCCCTGGTGGCGCCCAGGAG
CCCCCTAAGACGACGCTCTGGTAAGTTGTCTTTGGAGTCTTGAGGTAGATCAGCTGCTAACTGGCCACGTCAGGA
TGGGCGAATTGGAGCCTTGGATGGACGAAAACTTTATCAAGGGCGTCTTTCTTTCATCAGCTGGTGAAAATGTCA
ACGTCAAGGTTATTCGTGACAAGAACTCGGGGTAGGTGCACCATGCTTCTCTTTTGGCCTTGCCTGTCATGCTTA
TTGACGCCTCGAAGTAATGCTGGCTACTGCTTTGTCGAGTTTACCACTCCCGATGCCGCCACCAAAGCCTTGAAC
CTAAATGGGTCTCCGGTTCCGAACTCCTCGCGCCAATTCAAGCTCAACTGGGCTTCTGGTGGCGGCCTTGTTGAC
CGACGGTACGTGCATGTGTAAGATGTTTTGGCTCGTCGGACCAAGCTGACATGACTTTCAAAAAAAAGCGATGAT
CGTGGCCCCGAATACAGCATCTTTGTGGGCGATCTGGGTCCTGAGGTTAACGAATACGTTTTGGTTTCTCTGTTC
CAAGCTCGCTTCCCGTCTTGCAAGTCTGCCAAAATCATGACGGACGCCATGTCGGGCCAGAGTCGTGGCTACGGA
TTCGTTCGCTTCTCAGACGAAAACGACCAGCAGCGCGCCCTGGTGGAAATGCAGGGCGTGTACTGTGGCAACAGG
CCTATGAGAATCTCCACGGCCACACCTAAGAATCGGTAAGGAGACTCTGGTCGAATTTGAATAAGTGCAAAGCTT
ACAAGGCTTCAGTGGCAATCATGGTTTTGCAGGGCACGGTCACCATGCCGGCGGTCCCATGATGGGAGGCGGTAT
GCCTCCTCAGCAGATGTGGGGACAAGTAGGGGGATTCCCGTACGGTGGATATAATCCAGCCACGCAGATGAACCA
GTTTACGGACCCAAACAACACGACGGTCTTTGTCGGTGGTCTTTCCGGCTATGTGACCGAGGACGAGCTCCGATC
ATTCTTCCAGGGATTTGGTGAAATCACCTATGTCAAGATTCCCCCCGGCAAGGGCTGTGGTTTTGTTCAGTTTGT
CCACCGCCATGCTGCCGAGATGGCCATCAACCAAATGCAGGGTTATCCCATTGGCAATTCTCGTGTCCGCCTTAG
CTGGGGACGTTCTCAGAACAACTCTGGTGTGGGTACTCCTTATCGCCCTGCACCCCCTCCCCCTCATTACATGGG
AATGCCTGGCCATGGCCCTGGACCATATGGTCCGCAGCACTTTGGGGGCCCAGGCTCTGCTATGCCCGGTCCACC
AGGTCCTCCTGGCCCTCCTGGTCCAGGTGGTCCCCAGGTAAGGCGTCTCTTGCTGTATAATGGTACAGGCGGCTA
ACTATTGTTGCATGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail