Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1430
Gene name
LocationContig_138:47887..51193
Strand+
Gene length (bp)3306
Transcript length (bp)3192
Coding sequence length (bp)3192
Protein length (aa) 1064

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.0E-31 22 351
PF07993 NAD_binding_4 Male sterility protein 8.4E-29 698 934
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.6E-10 696 935
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-06 575 646

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 80 924 2.0E-19
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 589 939 6.0E-17
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 587 953 9.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 594 1002 3.0E-16
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 589 936 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 80 924 2.0E-19
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 589 939 6.0E-17
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 587 953 9.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 594 1002 3.0E-16
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 589 936 6.0E-15
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 550 996 7.0E-15
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 591 1000 8.0E-12
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 408 959 6.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 550 989 7.0E-10
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 661 1017 2.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 36 471 2.0E-08
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 42 343 4.0E-08
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 42 343 4.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 689 997 7.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 182 474 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1430
MAISKNEYQSRLGQRVVVNVVDETAATEPNRPFIYTPRGTTPEEGWKPVSFSELANAVNAMAWVIADKIKANSNE
PFPTLAYIGPDDIRYVIMMLACIKAGCKALFISPRNSLEGQLSLFENTSCKDVWHTQSFADTVMRWKAAHPELRV
AKVGSLDDLLNVDEAKHFPYQRDFEVARFEPAFVLHTSGSTGIPKPIVVRHGNVALMDAGQNVPLFHNKPGMFDK
LRATSSRLFAPMPFYHAACIYGTVVKMAIFAGTAPVMTIPKRPLTPELALKCIQHSGSDSAFLPPSILEEMTSNE
DYRKRMQGLKAVLFGGGNLSKPAGDAMFNMNILLFNFIGSTESTPFALYHQEHQEYWQYFVMDSERMGNHWICHD
EQEGIYELTIRRKSPKDPLDQAIFYTFPHLNEWSTGDLYRKHPTLPDCWIHHGRADNIIVFSTGEKLNPVTIEET
VVGHPAVKGALVVGGQRLQAALIIEPRTACNNEAEEQALIDSVWPVIEEANRVTVGHGQIVRRFVAVSDANKPFH
RASKGTIQRAATIKEYTDFINALYDRADEDENVHDAAPLDLTTNESLTQSIVEVFRSRLGVGAIQPDSDFFTLGV
DSLKVLSLCSLLRSSFRALGTSIDHKAIVARAIYANPTPRSLASHLRALIDGKGPEGSEVERETKVLGELVEKYT
RDLPPKPATAKPDPLDHGQTVLLTGTTGSLGAYMLDILCASPNVAKVVAMNRGADGGRWRQDSVCESRGLSPDMS
KIEFLGVDLSQPHFGLEEAKYHELLASADRIIHNSWPVNFNMGVASFEPHIRGVRHLVDFSAAAAKNVAIVFISS
IGSVARWNRPGQSVPEERLNDLSLAHMGYGRSKLASSLILDEAARQCGIPAASVRVGQIAGPRGAKGQWNKQELP
PTMIASSLYLGILPQSIGWRDTVDWTPVEDVANMVTDVAGVTNQVAVQDISGYFHAVNPQKTTWAKLAPAIVDFY
GGRISNLVPIQEWVAALEQSATGAHVDVERNPAVKLIDSFREMIASGNNDAEPFNFDMKRTMSRSPTVAKLGPVT
PEIIKHWCAQWQY*
Coding >OphauB2|1430
ATGGCCATTAGCAAAAATGAGTACCAGTCGCGCCTGGGCCAACGCGTCGTTGTCAATGTTGTTGATGAAACTGCT
GCCACGGAACCCAATCGCCCCTTTATATACACCCCCCGTGGCACAACACCAGAAGAGGGCTGGAAGCCGGTGAGC
TTCAGTGAGCTGGCAAACGCAGTCAATGCCATGGCCTGGGTCATAGCCGACAAGATCAAAGCCAACTCGAACGAG
CCTTTCCCAACACTGGCATACATTGGCCCCGACGACATTCGCTATGTCATCATGATGCTGGCCTGTATCAAGGCC
GGCTGCAAGGCTCTCTTCATCTCACCCCGCAACAGTCTCGAGGGCCAGCTGAGTCTGTTTGAGAACACGTCGTGC
AAGGATGTCTGGCACACCCAATCTTTTGCCGATACCGTCATGCGGTGGAAGGCGGCGCACCCAGAACTCCGTGTC
GCCAAGGTTGGCTCTTTGGACGACTTGCTCAACGTCGACGAGGCCAAGCATTTCCCTTACCAGCGCGACTTTGAG
GTGGCGCGCTTCGAGCCAGCCTTTGTCCTGCACACGAGCGGCTCAACAGGCATTCCCAAGCCCATCGTCGTCCGC
CACGGCAATGTGGCTCTAATGGACGCCGGCCAAAACGTGCCGCTCTTCCACAACAAGCCAGGCATGTTTGACAAG
CTTCGAGCCACCAGCTCGCGCCTCTTTGCTCCCATGCCCTTTTACCATGCCGCATGTATCTATGGCACAGTGGTC
AAGATGGCCATCTTTGCGGGCACGGCACCCGTCATGACCATTCCAAAGCGTCCTCTGACGCCAGAGCTGGCGCTC
AAGTGTATCCAACACTCGGGCTCTGACAGTGCCTTTTTGCCGCCTTCAATTCTCGAGGAGATGACTTCCAACGAG
GATTATCGCAAACGCATGCAAGGTCTCAAGGCCGTCCTTTTTGGCGGAGGTAATCTTTCCAAGCCAGCCGGCGAT
GCCATGTTCAACATGAACATTCTTCTCTTCAACTTTATTGGCTCTACAGAGAGCACGCCATTTGCCCTTTACCAC
CAGGAGCACCAAGAATACTGGCAGTACTTTGTCATGGACAGCGAGCGCATGGGCAATCACTGGATCTGCCATGAC
GAGCAAGAGGGCATTTACGAACTCACCATACGGCGCAAGAGTCCCAAGGATCCCCTCGACCAAGCCATCTTCTAC
ACCTTTCCTCACCTCAACGAATGGTCGACGGGCGACTTGTACAGGAAGCACCCGACCCTACCGGATTGCTGGATT
CACCACGGTCGTGCTGATAACATCATTGTCTTCTCCACGGGCGAGAAGCTGAATCCCGTCACTATAGAGGAGACG
GTGGTTGGTCACCCTGCCGTAAAGGGAGCCCTAGTTGTCGGCGGCCAGCGTCTTCAGGCAGCTCTCATCATTGAG
CCCCGCACAGCCTGCAACAATGAAGCCGAGGAGCAGGCCCTCATCGACTCTGTCTGGCCTGTTATTGAAGAGGCC
AACAGGGTCACCGTCGGACACGGCCAGATTGTTCGTCGCTTTGTCGCCGTCTCGGACGCGAATAAGCCCTTTCAT
CGAGCCTCAAAAGGCACCATCCAGCGCGCAGCAACCATCAAGGAGTACACCGACTTTATCAATGCGCTTTACGAC
AGAGCCGACGAGGACGAGAATGTCCATGACGCCGCGCCTCTAGACCTGACGACCAATGAGAGCCTGACGCAGTCC
ATTGTAGAAGTGTTCCGCTCCAGACTTGGCGTAGGCGCCATACAGCCCGACAGCGACTTTTTTACCCTGGGTGTC
GACTCGTTAAAGGTGCTGAGCCTATGCAGCCTTTTGCGTTCCAGTTTCAGGGCTCTGGGCACCTCCATCGACCAC
AAGGCCATTGTGGCTCGCGCTATTTACGCCAATCCGACACCGCGAAGCTTGGCCTCACATCTCCGCGCTCTCATT
GACGGAAAAGGGCCAGAGGGAAGCGAGGTGGAGCGTGAGACAAAAGTCCTCGGAGAGCTCGTCGAAAAGTACACC
CGCGACCTGCCACCCAAGCCTGCGACGGCAAAGCCTGATCCCTTGGACCATGGACAGACGGTGCTTTTGACGGGC
ACCACGGGCTCACTGGGAGCCTACATGCTCGACATTCTCTGTGCCAGCCCCAACGTGGCCAAGGTGGTGGCTATG
AACCGTGGAGCTGACGGTGGCCGTTGGCGCCAGGACTCGGTGTGCGAGTCGCGGGGTCTGAGTCCCGACATGTCC
AAGATTGAGTTCCTGGGCGTGGACCTGTCACAGCCTCACTTTGGACTGGAAGAGGCCAAGTACCATGAGCTGTTG
GCGTCGGCGGATCGCATCATCCACAACTCGTGGCCCGTCAACTTCAACATGGGCGTTGCGTCGTTTGAGCCTCAC
ATCCGCGGAGTGCGCCACTTGGTCGACTTTTCCGCTGCCGCAGCAAAAAACGTTGCCATTGTCTTCATCTCGAGC
ATCGGCTCCGTGGCACGGTGGAATCGCCCGGGCCAGTCTGTGCCCGAGGAGCGGCTCAACGACCTCAGCCTGGCA
CACATGGGCTATGGTCGCAGCAAGCTCGCCAGCAGCCTCATCCTCGACGAGGCGGCACGTCAATGCGGCATCCCT
GCAGCCTCGGTTCGTGTTGGGCAGATTGCGGGCCCGCGTGGAGCCAAGGGCCAGTGGAACAAACAGGAGCTGCCA
CCAACCATGATTGCCAGCTCGCTCTACCTGGGAATCCTTCCACAAAGCATTGGCTGGCGCGACACGGTCGACTGG
ACGCCTGTCGAGGACGTAGCCAACATGGTGACTGACGTGGCGGGCGTCACCAACCAGGTCGCTGTCCAAGACATC
AGCGGCTACTTCCACGCCGTCAACCCGCAAAAGACCACCTGGGCCAAACTGGCGCCCGCCATTGTCGACTTTTAC
GGCGGCCGCATCTCCAACTTGGTGCCCATCCAGGAGTGGGTTGCGGCGCTGGAGCAGAGCGCTACCGGTGCCCAC
GTAGACGTCGAGCGAAACCCGGCCGTCAAGCTCATCGACTCATTTAGAGAAATGATTGCATCTGGCAACAATGAC
GCCGAGCCCTTCAATTTCGATATGAAGCGCACCATGAGCCGCAGCCCAACAGTGGCCAAGCTGGGCCCAGTGACG
CCTGAAATAATTAAGCACTGGTGTGCACAGTGGCAGTATTAG
Transcript >OphauB2|1430
ATGGCCATTAGCAAAAATGAGTACCAGTCGCGCCTGGGCCAACGCGTCGTTGTCAATGTTGTTGATGAAACTGCT
GCCACGGAACCCAATCGCCCCTTTATATACACCCCCCGTGGCACAACACCAGAAGAGGGCTGGAAGCCGGTGAGC
TTCAGTGAGCTGGCAAACGCAGTCAATGCCATGGCCTGGGTCATAGCCGACAAGATCAAAGCCAACTCGAACGAG
CCTTTCCCAACACTGGCATACATTGGCCCCGACGACATTCGCTATGTCATCATGATGCTGGCCTGTATCAAGGCC
GGCTGCAAGGCTCTCTTCATCTCACCCCGCAACAGTCTCGAGGGCCAGCTGAGTCTGTTTGAGAACACGTCGTGC
AAGGATGTCTGGCACACCCAATCTTTTGCCGATACCGTCATGCGGTGGAAGGCGGCGCACCCAGAACTCCGTGTC
GCCAAGGTTGGCTCTTTGGACGACTTGCTCAACGTCGACGAGGCCAAGCATTTCCCTTACCAGCGCGACTTTGAG
GTGGCGCGCTTCGAGCCAGCCTTTGTCCTGCACACGAGCGGCTCAACAGGCATTCCCAAGCCCATCGTCGTCCGC
CACGGCAATGTGGCTCTAATGGACGCCGGCCAAAACGTGCCGCTCTTCCACAACAAGCCAGGCATGTTTGACAAG
CTTCGAGCCACCAGCTCGCGCCTCTTTGCTCCCATGCCCTTTTACCATGCCGCATGTATCTATGGCACAGTGGTC
AAGATGGCCATCTTTGCGGGCACGGCACCCGTCATGACCATTCCAAAGCGTCCTCTGACGCCAGAGCTGGCGCTC
AAGTGTATCCAACACTCGGGCTCTGACAGTGCCTTTTTGCCGCCTTCAATTCTCGAGGAGATGACTTCCAACGAG
GATTATCGCAAACGCATGCAAGGTCTCAAGGCCGTCCTTTTTGGCGGAGGTAATCTTTCCAAGCCAGCCGGCGAT
GCCATGTTCAACATGAACATTCTTCTCTTCAACTTTATTGGCTCTACAGAGAGCACGCCATTTGCCCTTTACCAC
CAGGAGCACCAAGAATACTGGCAGTACTTTGTCATGGACAGCGAGCGCATGGGCAATCACTGGATCTGCCATGAC
GAGCAAGAGGGCATTTACGAACTCACCATACGGCGCAAGAGTCCCAAGGATCCCCTCGACCAAGCCATCTTCTAC
ACCTTTCCTCACCTCAACGAATGGTCGACGGGCGACTTGTACAGGAAGCACCCGACCCTACCGGATTGCTGGATT
CACCACGGTCGTGCTGATAACATCATTGTCTTCTCCACGGGCGAGAAGCTGAATCCCGTCACTATAGAGGAGACG
GTGGTTGGTCACCCTGCCGTAAAGGGAGCCCTAGTTGTCGGCGGCCAGCGTCTTCAGGCAGCTCTCATCATTGAG
CCCCGCACAGCCTGCAACAATGAAGCCGAGGAGCAGGCCCTCATCGACTCTGTCTGGCCTGTTATTGAAGAGGCC
AACAGGGTCACCGTCGGACACGGCCAGATTGTTCGTCGCTTTGTCGCCGTCTCGGACGCGAATAAGCCCTTTCAT
CGAGCCTCAAAAGGCACCATCCAGCGCGCAGCAACCATCAAGGAGTACACCGACTTTATCAATGCGCTTTACGAC
AGAGCCGACGAGGACGAGAATGTCCATGACGCCGCGCCTCTAGACCTGACGACCAATGAGAGCCTGACGCAGTCC
ATTGTAGAAGTGTTCCGCTCCAGACTTGGCGTAGGCGCCATACAGCCCGACAGCGACTTTTTTACCCTGGGTGTC
GACTCGTTAAAGGTGCTGAGCCTATGCAGCCTTTTGCGTTCCAGTTTCAGGGCTCTGGGCACCTCCATCGACCAC
AAGGCCATTGTGGCTCGCGCTATTTACGCCAATCCGACACCGCGAAGCTTGGCCTCACATCTCCGCGCTCTCATT
GACGGAAAAGGGCCAGAGGGAAGCGAGGTGGAGCGTGAGACAAAAGTCCTCGGAGAGCTCGTCGAAAAGTACACC
CGCGACCTGCCACCCAAGCCTGCGACGGCAAAGCCTGATCCCTTGGACCATGGACAGACGGTGCTTTTGACGGGC
ACCACGGGCTCACTGGGAGCCTACATGCTCGACATTCTCTGTGCCAGCCCCAACGTGGCCAAGGTGGTGGCTATG
AACCGTGGAGCTGACGGTGGCCGTTGGCGCCAGGACTCGGTGTGCGAGTCGCGGGGTCTGAGTCCCGACATGTCC
AAGATTGAGTTCCTGGGCGTGGACCTGTCACAGCCTCACTTTGGACTGGAAGAGGCCAAGTACCATGAGCTGTTG
GCGTCGGCGGATCGCATCATCCACAACTCGTGGCCCGTCAACTTCAACATGGGCGTTGCGTCGTTTGAGCCTCAC
ATCCGCGGAGTGCGCCACTTGGTCGACTTTTCCGCTGCCGCAGCAAAAAACGTTGCCATTGTCTTCATCTCGAGC
ATCGGCTCCGTGGCACGGTGGAATCGCCCGGGCCAGTCTGTGCCCGAGGAGCGGCTCAACGACCTCAGCCTGGCA
CACATGGGCTATGGTCGCAGCAAGCTCGCCAGCAGCCTCATCCTCGACGAGGCGGCACGTCAATGCGGCATCCCT
GCAGCCTCGGTTCGTGTTGGGCAGATTGCGGGCCCGCGTGGAGCCAAGGGCCAGTGGAACAAACAGGAGCTGCCA
CCAACCATGATTGCCAGCTCGCTCTACCTGGGAATCCTTCCACAAAGCATTGGCTGGCGCGACACGGTCGACTGG
ACGCCTGTCGAGGACGTAGCCAACATGGTGACTGACGTGGCGGGCGTCACCAACCAGGTCGCTGTCCAAGACATC
AGCGGCTACTTCCACGCCGTCAACCCGCAAAAGACCACCTGGGCCAAACTGGCGCCCGCCATTGTCGACTTTTAC
GGCGGCCGCATCTCCAACTTGGTGCCCATCCAGGAGTGGGTTGCGGCGCTGGAGCAGAGCGCTACCGGTGCCCAC
GTAGACGTCGAGCGAAACCCGGCCGTCAAGCTCATCGACTCATTTAGAGAAATGATTGCATCTGGCAACAATGAC
GCCGAGCCCTTCAATTTCGATATGAAGCGCACCATGAGCCGCAGCCCAACAGTGGCCAAGCTGGGCCCAGTGACG
CCTGAAATAATTAAGCACTGGTGTGCACAGTGGCAGTATTAG
Gene >OphauB2|1430
ATGGCCATTAGCAAAAATGAGTACCAGTCGCGCCTGGGCCAACGCGTCGTTGTCAATGTTGTTGATGAAACTGCT
GCCACGGAACCCAATCGCCCCTTTATATACACCCCCCGTGGCACAACACCAGAAGAGGGCTGGAAGCCGGTGAGC
TTCAGTGAGCTGGCAAACGCAGTCAATGCCATGGCCTGGGTCATAGCCGACAAGATCAAAGCCAACTCGAACGAG
CCTTTCCCAACACTGGCATACATTGGCCCCGACGACATTCGCTATGTCATCATGATGCTGGCCTGTATCAAGGCC
GGCTGCAAGGCTCTCTTCATCTCACCCCGCAACAGTCTCGAGGGCCAGCTGAGTCTGTTTGAGAACACGTCGTGC
AAGGATGTCTGGCACACCCAATCTTTTGCCGATACCGTCATGCGGTGGAAGGCGGCGCACCCAGAACTCCGTGTC
GCCAAGGTTGGCTCTTTGGACGACTTGCTCAACGTCGACGAGGCCAAGCATTTCCCTTACCAGCGCGACTTTGAG
GTGGCGCGCTTCGAGCCAGCCTTTGTCCTGCACACGAGCGGCTCAACAGGCATTCCCAAGCCCATCGTCGTCCGC
CACGGCAATGTGGCTCTAATGGACGCCGGCCAAAACGTGCCGCTCTTCCACAACAAGCCAGGCATGTTTGACAAG
CTTCGAGCCACCAGCTCGCGCCTCTTTGCTCCCATGCCCTTTTACCATGCCGCATGTATCTATGGCACAGTGGTC
AAGATGGCCATCTTTGCGGGCACGGCACCCGTCATGACCATTCCAAAGCGTCCTCTGACGCCAGAGCTGGCGCTC
AAGTGTATCCAACACTCGGGCTCTGACAGTGCCTTTTTGCCGCCTTCAATTCTCGAGGAGATGACTTCCAACGAG
GATTATCGCAAACGCATGCAAGGTCTCAAGGCCGTCCTTTTTGGCGGAGGTGGGTCAACCAGCCGCTCTCTTGAT
GCATCGCGAGGCTGACTTGTTTTCTTTGCAGGTAATCTTTCCAAGCCAGCCGGCGATGCCATGTTCAACATGAAC
ATTCTTCTCTTCAACTTTATTGGCTCTACAGAGTAAGTCAATCAGTCAGCTATGCTGCATCCCAAGTTCCACTGC
TGACACATTTCTAGGAGCACGCCATTTGCCCTTTACCACCAGGAGCACCAAGAATACTGGCAGTACTTTGTCATG
GACAGCGAGCGCATGGGCAATCACTGGATCTGCCATGACGAGCAAGAGGGCATTTACGAACTCACCATACGGCGC
AAGAGTCCCAAGGATCCCCTCGACCAAGCCATCTTCTACACCTTTCCTCACCTCAACGAATGGTCGACGGGCGAC
TTGTACAGGAAGCACCCGACCCTACCGGATTGCTGGATTCACCACGGTCGTGCTGATAACATCATTGTCTTCTCC
ACGGGCGAGAAGCTGAATCCCGTCACTATAGAGGAGACGGTGGTTGGTCACCCTGCCGTAAAGGGAGCCCTAGTT
GTCGGCGGCCAGCGTCTTCAGGCAGCTCTCATCATTGAGCCCCGCACAGCCTGCAACAATGAAGCCGAGGAGCAG
GCCCTCATCGACTCTGTCTGGCCTGTTATTGAAGAGGCCAACAGGGTCACCGTCGGACACGGCCAGATTGTTCGT
CGCTTTGTCGCCGTCTCGGACGCGAATAAGCCCTTTCATCGAGCCTCAAAAGGCACCATCCAGCGCGCAGCAACC
ATCAAGGAGTACACCGACTTTATCAATGCGCTTTACGACAGAGCCGACGAGGACGAGAATGTCCATGACGCCGCG
CCTCTAGACCTGACGACCAATGAGAGCCTGACGCAGTCCATTGTAGAAGTGTTCCGCTCCAGACTTGGCGTAGGC
GCCATACAGCCCGACAGCGACTTTTTTACCCTGGGTGTCGACTCGTTAAAGGTGCTGAGCCTATGCAGCCTTTTG
CGTTCCAGTTTCAGGGCTCTGGGCACCTCCATCGACCACAAGGCCATTGTGGCTCGCGCTATTTACGCCAATCCG
ACACCGCGAAGCTTGGCCTCACATCTCCGCGCTCTCATTGACGGAAAAGGGCCAGAGGGAAGCGAGGTGGAGCGT
GAGACAAAAGTCCTCGGAGAGCTCGTCGAAAAGTACACCCGCGACCTGCCACCCAAGCCTGCGACGGCAAAGCCT
GATCCCTTGGACCATGGACAGACGGTGCTTTTGACGGGCACCACGGGCTCACTGGGAGCCTACATGCTCGACATT
CTCTGTGCCAGCCCCAACGTGGCCAAGGTGGTGGCTATGAACCGTGGAGCTGACGGTGGCCGTTGGCGCCAGGAC
TCGGTGTGCGAGTCGCGGGGTCTGAGTCCCGACATGTCCAAGATTGAGTTCCTGGGCGTGGACCTGTCACAGCCT
CACTTTGGACTGGAAGAGGCCAAGTACCATGAGCTGTTGGCGTCGGCGGATCGCATCATCCACAACTCGTGGCCC
GTCAACTTCAACATGGGCGTTGCGTCGTTTGAGCCTCACATCCGCGGAGTGCGCCACTTGGTCGACTTTTCCGCT
GCCGCAGCAAAAAACGTTGCCATTGTCTTCATCTCGAGCATCGGCTCCGTGGCACGGTGGAATCGCCCGGGCCAG
TCTGTGCCCGAGGAGCGGCTCAACGACCTCAGCCTGGCACACATGGGCTATGGTCGCAGCAAGCTCGCCAGCAGC
CTCATCCTCGACGAGGCGGCACGTCAATGCGGCATCCCTGCAGCCTCGGTTCGTGTTGGGCAGATTGCGGGCCCG
CGTGGAGCCAAGGGCCAGTGGAACAAACAGGAGCTGCCACCAACCATGATTGCCAGCTCGCTCTACCTGGGAATC
CTTCCACAAAGCATTGGCTGGCGCGACACGGTCGACTGGACGCCTGTCGAGGACGTAGCCAACATGGTGACTGAC
GTGGCGGGCGTCACCAACCAGGTCGCTGTCCAAGACATCAGCGGCTACTTCCACGCCGTCAACCCGCAAAAGACC
ACCTGGGCCAAACTGGCGCCCGCCATTGTCGACTTTTACGGCGGCCGCATCTCCAACTTGGTGCCCATCCAGGAG
TGGGTTGCGGCGCTGGAGCAGAGCGCTACCGGTGCCCACGTAGACGTCGAGCGAAACCCGGCCGTCAAGCTCATC
GACTCATTTAGAGAAATGATTGCATCTGGCAACAATGACGCCGAGCCCTTCAATTTCGATATGAAGCGCACCATG
AGCCGCAGCCCAACAGTGGCCAAGCTGGGCCCAGTGACGCCTGAAATAATTAAGCACTGGTGTGCACAGTGGCAG
TATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail