Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1428
Gene name
LocationContig_138:42250..42884
Strand-
Gene length (bp)634
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 5.6E-20 97 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 81 163 1.0E-10
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 100 163 3.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 163 6.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 163 3.0E-08
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 159 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 81 163 1.0E-10
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 100 163 3.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 163 6.0E-10
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 163 3.0E-08
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 97 159 8.0E-08
sp|P79073|HYP2_HYPJE Hydrophobin-2 OS=Hypocrea jecorina GN=hfb2 PE=1 SV=1 92 163 4.0E-07
sp|Q06153|CEUL_OPHUL Cerato-ulmin OS=Ophiostoma ulmi GN=CU PE=1 SV=1 94 163 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1428
MKSFVIAALFAFASAVPSGQGASSNNGGYYPVPYGSGHNGHSGSGHGHHHGNGNGNGNGNGNGNGNGNDGDWHPV
NPGGDDDGNNGSGNVPSIDDFCPRSGLLGNPFCCTTDVINLLDLRCEFPTKPYSSLTSLKQICQDEGRVARCCAV
PVIGQALICEDTV*
Coding >OphauB2|1428
ATGAAGTCGTTTGTCATTGCTGCTCTTTTCGCTTTTGCTTCGGCCGTGCCTTCTGGCCAAGGGGCCTCGAGCAAC
AACGGGGGCTACTATCCCGTTCCATATGGCTCGGGCCACAATGGCCACTCGGGCTCTGGTCATGGCCACCACCAT
GGCAACGGCAACGGCAATGGCAATGGCAATGGCAATGGCAACGGCAATGGCAACGACGGCGACTGGCACCCCGTG
AATCCTGGTGGCGATGATGACGGCAACAATGGCAGCGGAAATGTTCCCAGCATTGATGACTTTTGTCCTCGAAGC
GGTCTTCTTGGCAACCCTTTTTGCTGCACCACTGATGTCATCAACTTGCTCGATCTTCGATGTGAATTTCCCACG
AAACCCTACTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATGAAGGCCGCGTGGCTAGATGCTGCGCCGTC
CCTGTGATTGGCCAGGCTTTGATCTGCGAGGACACCGTCTAA
Transcript >OphauB2|1428
ATGAAGTCGTTTGTCATTGCTGCTCTTTTCGCTTTTGCTTCGGCCGTGCCTTCTGGCCAAGGGGCCTCGAGCAAC
AACGGGGGCTACTATCCCGTTCCATATGGCTCGGGCCACAATGGCCACTCGGGCTCTGGTCATGGCCACCACCAT
GGCAACGGCAACGGCAATGGCAATGGCAATGGCAATGGCAACGGCAATGGCAACGACGGCGACTGGCACCCCGTG
AATCCTGGTGGCGATGATGACGGCAACAATGGCAGCGGAAATGTTCCCAGCATTGATGACTTTTGTCCTCGAAGC
GGTCTTCTTGGCAACCCTTTTTGCTGCACCACTGATGTCATCAACTTGCTCGATCTTCGATGTGAATTTCCCACG
AAACCCTACTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATGAAGGCCGCGTGGCTAGATGCTGCGCCGTC
CCTGTGATTGGCCAGGCTTTGATCTGCGAGGACACCGTCTAA
Gene >OphauB2|1428
ATGAAGTCGTTTGTCATTGCTGCTCTTTTCGCTTTTGCTTCGGCCGTGCCTTCTGGCCAAGGGGCCTCGAGCAAC
AACGGGGGCTACTATCCCGTTCCATATGGCTCGGGCCACAATGGCCACTCGGGCTCTGGTCATGGCCACCACCAT
GGCAACGGCAACGGCAATGGCAATGGCAATGGCAATGGCAACGGCAATGGCAACGACGGCGACTGGCACCCCGTG
AATCCTGGTGGCGATGATGACGGCAACAATGGCAGCGGAAATGTTCCCAGCATTGATGACTTTTGTCCTCGAAGC
GGTCTTCTTGGCAACCCTTTTTGCTGCACCACTGATGTCATCAACTTGCTCGATCTTCGATGTGAATTTCGTACG
TTGTTATTCTTTTGTTTCTTCTCTTTTTTTTCAATCTATAACAGTACATGAGCTAATGTGCCTCGACTAGCCACG
AAACCCTACTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATGAAGGCCGCGTGGCTAGATGCTGCGCCGTC
CCTGTGGTAAGTGCTGCCTCGACGCTTGCCGGTAATCAAACGACTCGACTAACCCGTCTCCCTTTTTCAACAGAT
TGGCCAGGCTTTGATCTGCGAGGACACCGTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail