Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1426
Gene name
LocationContig_138:36727..38880
Strand-
Gene length (bp)2153
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01144 CoA_trans Coenzyme A transferase 3.4E-59 47 278
PF01144 CoA_trans Coenzyme A transferase 2.9E-38 315 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens GN=OXCT1 PE=1 SV=1 10 528 1.0E-173
sp|Q9D0K2|SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus GN=Oxct1 PE=1 SV=1 10 528 8.0E-171
sp|B2GV06|SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus GN=Oxct1 PE=1 SV=1 10 528 6.0E-170
sp|Q29551|SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa GN=OXCT1 PE=1 SV=2 34 528 5.0E-168
sp|Q54JD9|SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum GN=oxct1 PE=3 SV=1 32 528 2.0E-159
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens GN=OXCT1 PE=1 SV=1 10 528 1.0E-173
sp|Q9D0K2|SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus GN=Oxct1 PE=1 SV=1 10 528 8.0E-171
sp|B2GV06|SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus GN=Oxct1 PE=1 SV=1 10 528 6.0E-170
sp|Q29551|SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa GN=OXCT1 PE=1 SV=2 34 528 5.0E-168
sp|Q54JD9|SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum GN=oxct1 PE=3 SV=1 32 528 2.0E-159
sp|Q09450|SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans GN=C05C10.3 PE=3 SV=1 43 527 6.0E-156
sp|Q9BYC2|SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens GN=OXCT2 PE=2 SV=2 43 528 3.0E-154
sp|Q9ESL0|SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus GN=Oxct2b PE=2 SV=1 48 528 1.0E-151
sp|Q9JJN4|SCO2A_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Mus musculus GN=Oxct2a PE=1 SV=2 48 528 2.0E-151
sp|Q5XIJ9|SCO2A_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Rattus norvegicus GN=Oxct2a PE=1 SV=1 19 528 7.0E-150
sp|P42316|SCOB_BACSU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Bacillus subtilis (strain 168) GN=scoB PE=1 SV=1 309 524 8.0E-78
sp|B0RVK3|SCOB_XANCB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Xanthomonas campestris pv. campestris (strain B100) GN=lpsJ PE=3 SV=1 312 518 4.0E-77
sp|P0C7I8|SCOB_XANCP Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lpsJ PE=3 SV=1 312 518 4.0E-77
sp|P56007|SCOB_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=scoB PE=1 SV=1 312 520 2.0E-73
sp|Q9ZLE4|SCOB_HELPJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=scoB PE=3 SV=1 312 520 3.0E-73
sp|P9WPW3|SCOB_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=scoB PE=1 SV=1 312 522 9.0E-71
sp|P9WPW2|SCOB_MYCTO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=scoB PE=3 SV=1 312 522 9.0E-71
sp|P63651|SCOB_MYCBO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=scoB PE=3 SV=1 312 522 9.0E-71
sp|B0RVK4|SCOA_XANCB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Xanthomonas campestris pv. campestris (strain B100) GN=lpsI PE=3 SV=1 56 291 3.0E-68
sp|P0C7I7|SCOA_XANCP Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lpsI PE=3 SV=1 56 291 1.0E-66
sp|P42315|SCOA_BACSU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Bacillus subtilis (strain 168) GN=scoA PE=1 SV=1 44 299 4.0E-65
sp|P9WPW5|SCOA_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=scoA PE=1 SV=1 55 291 7.0E-64
sp|P9WPW4|SCOA_MYCTO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=scoA PE=3 SV=1 55 291 7.0E-64
sp|P63649|SCOA_MYCBO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=scoA PE=3 SV=1 55 291 7.0E-64
sp|Q9ZLE3|SCOA_HELPJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=scoA PE=3 SV=1 43 286 1.0E-63
sp|P56006|SCOA_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=scoA PE=1 SV=1 43 291 4.0E-63
sp|P76459|ATOA_ECOLI Acetate CoA-transferase subunit beta OS=Escherichia coli (strain K12) GN=atoA PE=1 SV=1 305 526 8.0E-60
sp|P23673|CTFB_CLOAB Butyrate--acetoacetate CoA-transferase subunit B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ctfB PE=1 SV=1 315 527 6.0E-59
sp|P44874|ATOA_HAEIN Acetate CoA-transferase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoA PE=3 SV=1 315 528 7.0E-54
sp|O34466|YODR_BACSU Probable coenzyme A transferase subunit beta OS=Bacillus subtilis (strain 168) GN=yodR PE=3 SV=1 311 520 2.0E-53
sp|P0A102|PCAJ_PSEPU 3-oxoadipate CoA-transferase subunit B OS=Pseudomonas putida GN=pcaJ PE=1 SV=2 312 518 5.0E-46
sp|P0A101|PCAJ_PSEPK 3-oxoadipate CoA-transferase subunit B OS=Pseudomonas putida (strain KT2440) GN=pcaJ PE=3 SV=2 312 518 5.0E-46
sp|Q59091|PCAJ_ACIAD 3-oxoadipate CoA-transferase subunit B OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaJ PE=1 SV=2 312 516 4.0E-45
sp|Q01103|PCAI_PSEPU 3-oxoadipate CoA-transferase subunit A OS=Pseudomonas putida GN=pcaI PE=1 SV=2 43 275 5.0E-44
sp|Q43973|PCAI_ACIAD 3-oxoadipate CoA-transferase subunit A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaI PE=1 SV=1 51 278 3.0E-43
sp|P76458|ATOD_ECOLI Acetate CoA-transferase subunit alpha OS=Escherichia coli (strain K12) GN=atoD PE=1 SV=1 49 283 3.0E-34
sp|P33752|CTFA_CLOAB Butyrate--acetoacetate CoA-transferase subunit A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ctfA PE=1 SV=1 57 277 3.0E-33
sp|O34317|YODS_BACSU Probable coenzyme A transferase subunit alpha OS=Bacillus subtilis (strain 168) GN=yodS PE=3 SV=1 49 277 1.0E-29
sp|P44875|ATOD_HAEIN Acetate CoA-transferase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoD PE=3 SV=1 56 277 1.0E-27
sp|P37766|YDIF_ECOLI Acetate CoA-transferase YdiF OS=Escherichia coli (strain K12) GN=ydiF PE=3 SV=3 51 509 1.0E-12
sp|Q8X5X6|YDIF_ECO57 Acetate CoA-transferase YdiF OS=Escherichia coli O157:H7 GN=ydiF PE=1 SV=1 51 509 2.0E-12
sp|Q8VPF2|CATJ_PSEKB 3-oxoadipate CoA-transferase subunit B OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=catJ PE=1 SV=1 319 524 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008410 CoA-transferase activity Yes
GO:0016782 transferase activity, transferring sulfur-containing groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1426
MAVTVGPLALTRSLGVGKTARVARRTFITSAIRYSQPAAVKYSKVVDDVDEAVADVKSGSTLLSAGFGLCGVAET
LIEALNRRGVGSLNSLTAVSNNAGLEGLGGLSTLTRAGQVKRLILSYLGNNKALEKGYLTGQLAIELCPQGTLAE
RLRAAGAGIPAFYTPTGAHTLLQDGKIAVRLDPSGKMLEGGTKRETRDFNGRSFLMETALPGDVAIVRAWKADRA
GNCVFRYTTKAFGPLMAKAARLTIVEAEHIVETGQIDPNDVHLPGIFVDRVVPATKDKQIEVLKIRDPAQDGSSP
KTPPVDAAQERRLRIGRRASRELKQGFYVNLGVGIPTLAATFIPPGRTVWVQSENGILGMGPYPTKDEVDADIVN
AGKETVTLVPGASCFDSSESFGMIRGGHVDVSILGALQVSAAGDLANFMIPGKVFKGMGGAMDLVANPDNTKIVV
ATEHVAKDGSSKIVKQCSLPLTGARVVSTIITDLCVFQVDRKRGTLTLTELAPGVTVDQVRSKTAAPFDVADQVA
TME*
Coding >OphauB2|1426
ATGGCTGTCACCGTGGGCCCCCTTGCGCTTACACGCAGTCTCGGCGTCGGCAAGACGGCGCGCGTGGCTCGGCGC
ACGTTTATCACGAGTGCGATTCGTTATTCTCAGCCCGCGGCGGTGAAATATTCCAAAGTGGTTGATGATGTGGAC
GAGGCCGTGGCAGATGTCAAGAGCGGCTCGACTCTGCTCAGCGCGGGCTTTGGGCTGTGTGGTGTGGCTGAAACA
CTTATCGAGGCGCTGAACCGCCGGGGTGTTGGCTCGCTCAATTCTCTCACGGCCGTCTCCAACAATGCTGGGCTC
GAGGGCCTGGGCGGCTTGTCGACGCTGACAAGGGCTGGGCAGGTGAAGCGTCTGATTTTGTCGTATTTGGGCAAC
AACAAGGCGCTGGAAAAGGGCTACTTGACGGGCCAGCTGGCCATTGAGCTGTGTCCGCAGGGGACGCTGGCTGAG
CGTCTGCGGGCGGCGGGCGCGGGCATTCCGGCCTTTTATACGCCTACTGGTGCTCACACTCTGCTCCAAGACGGC
AAAATCGCCGTCCGCCTCGACCCCTCGGGCAAGATGCTTGAAGGCGGCACCAAGCGCGAGACACGCGACTTCAAC
GGCCGCTCGTTCCTCATGGAAACGGCTCTGCCCGGCGACGTGGCCATTGTGCGTGCCTGGAAGGCCGACCGCGCC
GGCAACTGCGTCTTTCGATACACCACCAAGGCCTTTGGCCCCCTCATGGCCAAGGCCGCCCGCCTCACCATTGTC
GAGGCCGAACACATTGTCGAAACAGGCCAAATCGACCCCAACGACGTACACCTCCCCGGCATCTTTGTCGACCGC
GTCGTGCCCGCCACCAAGGACAAGCAAATCGAGGTTCTCAAGATTCGCGACCCCGCCCAAGACGGCTCCAGCCCC
AAGACGCCCCCCGTCGACGCCGCCCAGGAGCGCCGCTTGCGCATTGGCCGCCGTGCGTCGCGTGAGCTCAAGCAG
GGCTTCTACGTCAACTTGGGCGTCGGCATTCCTACCCTGGCCGCCACGTTTATTCCCCCGGGGCGCACCGTTTGG
GTGCAGAGTGAAAACGGCATACTTGGCATGGGGCCGTATCCTACAAAGGATGAGGTGGATGCGGATATTGTCAAT
GCTGGCAAGGAGACGGTGACGCTGGTGCCGGGCGCGTCGTGCTTTGACTCGAGTGAGTCGTTTGGCATGATTCGC
GGTGGCCATGTCGACGTGTCTATTCTTGGGGCCCTTCAGGTCAGCGCTGCGGGCGACTTGGCCAATTTTATGATT
CCCGGCAAGGTCTTCAAGGGCATGGGCGGCGCCATGGATCTCGTTGCCAACCCCGACAACACCAAGATTGTCGTT
GCCACTGAGCACGTGGCCAAGGATGGCTCCTCCAAGATTGTCAAGCAGTGCAGTCTGCCCCTGACGGGCGCCCGC
GTCGTCAGCACCATCATCACCGACTTGTGCGTCTTCCAAGTCGACCGCAAACGCGGCACCCTCACCCTCACCGAA
CTCGCCCCCGGCGTCACCGTTGACCAGGTCCGCTCCAAGACCGCGGCGCCCTTTGACGTTGCCGACCAAGTTGCC
ACCATGGAGTAG
Transcript >OphauB2|1426
ATGGCTGTCACCGTGGGCCCCCTTGCGCTTACACGCAGTCTCGGCGTCGGCAAGACGGCGCGCGTGGCTCGGCGC
ACGTTTATCACGAGTGCGATTCGTTATTCTCAGCCCGCGGCGGTGAAATATTCCAAAGTGGTTGATGATGTGGAC
GAGGCCGTGGCAGATGTCAAGAGCGGCTCGACTCTGCTCAGCGCGGGCTTTGGGCTGTGTGGTGTGGCTGAAACA
CTTATCGAGGCGCTGAACCGCCGGGGTGTTGGCTCGCTCAATTCTCTCACGGCCGTCTCCAACAATGCTGGGCTC
GAGGGCCTGGGCGGCTTGTCGACGCTGACAAGGGCTGGGCAGGTGAAGCGTCTGATTTTGTCGTATTTGGGCAAC
AACAAGGCGCTGGAAAAGGGCTACTTGACGGGCCAGCTGGCCATTGAGCTGTGTCCGCAGGGGACGCTGGCTGAG
CGTCTGCGGGCGGCGGGCGCGGGCATTCCGGCCTTTTATACGCCTACTGGTGCTCACACTCTGCTCCAAGACGGC
AAAATCGCCGTCCGCCTCGACCCCTCGGGCAAGATGCTTGAAGGCGGCACCAAGCGCGAGACACGCGACTTCAAC
GGCCGCTCGTTCCTCATGGAAACGGCTCTGCCCGGCGACGTGGCCATTGTGCGTGCCTGGAAGGCCGACCGCGCC
GGCAACTGCGTCTTTCGATACACCACCAAGGCCTTTGGCCCCCTCATGGCCAAGGCCGCCCGCCTCACCATTGTC
GAGGCCGAACACATTGTCGAAACAGGCCAAATCGACCCCAACGACGTACACCTCCCCGGCATCTTTGTCGACCGC
GTCGTGCCCGCCACCAAGGACAAGCAAATCGAGGTTCTCAAGATTCGCGACCCCGCCCAAGACGGCTCCAGCCCC
AAGACGCCCCCCGTCGACGCCGCCCAGGAGCGCCGCTTGCGCATTGGCCGCCGTGCGTCGCGTGAGCTCAAGCAG
GGCTTCTACGTCAACTTGGGCGTCGGCATTCCTACCCTGGCCGCCACGTTTATTCCCCCGGGGCGCACCGTTTGG
GTGCAGAGTGAAAACGGCATACTTGGCATGGGGCCGTATCCTACAAAGGATGAGGTGGATGCGGATATTGTCAAT
GCTGGCAAGGAGACGGTGACGCTGGTGCCGGGCGCGTCGTGCTTTGACTCGAGTGAGTCGTTTGGCATGATTCGC
GGTGGCCATGTCGACGTGTCTATTCTTGGGGCCCTTCAGGTCAGCGCTGCGGGCGACTTGGCCAATTTTATGATT
CCCGGCAAGGTCTTCAAGGGCATGGGCGGCGCCATGGATCTCGTTGCCAACCCCGACAACACCAAGATTGTCGTT
GCCACTGAGCACGTGGCCAAGGATGGCTCCTCCAAGATTGTCAAGCAGTGCAGTCTGCCCCTGACGGGCGCCCGC
GTCGTCAGCACCATCATCACCGACTTGTGCGTCTTCCAAGTCGACCGCAAACGCGGCACCCTCACCCTCACCGAA
CTCGCCCCCGGCGTCACCGTTGACCAGGTCCGCTCCAAGACCGCGGCGCCCTTTGACGTTGCCGACCAAGTTGCC
ACCATGGAGTAG
Gene >OphauB2|1426
ATGGCTGTCACCGTGGGCCCCCTTGCGCTTACACGCAGTCTCGGCGTCGGCAAGACGGCGCGCGTGGCTCGGCGC
ACGTTTATCACGAGTGCGATTCGTTATTCTCAGCCCGCGGCGGTGAAATATTCCAAAGTGGTTGATGATGTGGAC
GAGGCCGTGGCAGATGTCAAGAGCGGCTCGACTCTGCTCAGCGCGGGCTTTGGGCTGTGTGGTGTGGCTGGTAAG
GGTCTTTTTTTTTCTGGAATTCTTTTATAAAAAAAAAAGAAAAAAAGAGATGACGTGGGTTTTTGGAGAGACTGA
CGCAAGGATATATATAGAAACACTTATCGAGGCGCTGAACCGCCGGGGTGTTGGCTCGCTCAATTCTCTCACGGC
CGTCTCCAACAATGCTGGGCTCGAGGGCCTGGGCGGCTTGTCGACGCTGACAAGGGCTGGGCAGGTGAAGCGTCT
GATTTTGTCGTATTTGGGCAACAACAAGGCGCTGGAAAAGGGCTACTTGACGGGCCAGCTGGCCATTGAGCTGTG
TCCGCAGGGGACGCTGGCTGAGCGTCTGCGGGCGGCGGGCGCGGGCATTCCGGCCTTTTATACGCCTACTGGTGC
TCGTAAGTCGTGGACTCTTTCTTCTTCTAGTCTTGGGCTCTTGCTCTTCTAGTCATGGACCCTCTTCTCACAGCC
ACATAGACACTCTGCTCCAAGACGGCAAAATCGCCGTCCGCCTCGACCCCTCGGGCAAGATGCTTGAAGGCGGCA
CCAAGCGCGAGACACGCGACTTCAACGGCCGCTCGTTCCTCATGGAAACGGCTCTGCCCGGCGACGTGGCCATTG
TGCGTGCCTGGAAGGCCGACCGCGCCGGCAACTGCGTCTTTCGGTTCGTCTCTAGCAGCCCCCTCTTTTTTCCCC
TTTTTTCCCCTTCAACTCTCTCCCTCTCACCCTCTCGCCCTCTCTTCCCCCTTTCCCTCTCCCCCTCCCCCCTTT
ATATATATAAAAAAAACAGAAAAAAAGACCTCAACCCCCCTCGCTCACACTTCATAGATACACCACCAAGGCCTT
TGGCCCCCTCATGGCCAAGGCCGCCCGCCTCACCATTGTCGAGGCCGAACACATTGTCGAAACAGGCCAAATCGA
CCCCAACGACGTACACCTCCCCGGCATCTTTGTCGACCGCGTCGTGCCCGCCACCAAGGACAAGCAAATCGAGGT
TCTCAAGATTCGCGACCCCGCCCAAGACGGCTCCAGCCCCAAGACGCCCCCCGTCGACGCCGCCCAGGAGCGCCG
CTTGCGCATTGGCCGCCGTGCGTCGCGTGAGCTCAAGCAGGGCTTCTACGTCAACTTGGGCGTCGGCATTCCTAC
CCTGGCCGCCACGTTTATTCCCCCGGGGCGCACCGTTTGGGTGCAGAGTGAAAACGGCATACTTGGCATGGGGCC
GTATCCTACAAAGGATGAGGTGGATGCGGATATTGTCAATGCTGGCAAGGAGACGGTGACGCTGGTGCCGGGCGC
GTCGTGCTTTGACTCGAGTGAGTCGTTTGGCATGATTCGCGGTGGCCATGTCGACGTGTCTATTCTTGGGGTAAG
TTTTCTTTTGCCTCCTTTTTTTTTGGCATGTCGTCTTTTTTTTGGTTCTGGTGGCAAAGAAATACATTGCTAAAG
GGTCGTTTCTTGCTTGCTCTCTAGGCCCTTCAGGTCAGCGCTGCGGGCGACTTGGCCAATTTTATGATTCCCGGC
AAGGTCTTCAAGGGCATGGGCGGCGCCATGGATCTCGTTGCCAACCCCGACAACACCAAGATTGTCGTTGCCACT
GAGCACGTGGCCAAGGATGGCTCCTCCAAGATTGTCAAGCAGTGCAGTCTGCCCCTGACGGGCGCCCGCGTCGTC
AGCACCATCATCACCGACTTGGTAAGGCTGTCTCTCTTTCTCTCCCCCTCTCTCTCTCTCTCCCTCTCTCTCTCC
CTCCCCCCCCTCTTTCTCTCTCTATATATATATACACATCTTTACAAGCCTGCTAACCACCGCTACAGTGCGTCT
TCCAAGTCGACCGCAAACGCGGCACCCTCACCCTCACCGAACTCGCCCCCGGCGTCACCGTTGACCAGGTCCGCT
CCAAGACCGCGGCGCCCTTTGACGTTGCCGACCAAGTTGCCACCATGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail