Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1425
Gene name
LocationContig_138:35510..36424
Strand+
Gene length (bp)914
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0TVF9|ALG3_PHANO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ALG3 PE=3 SV=2 1 276 4.0E-75

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1425
MPTLSPSLKALIKAPFAHPNPAAPPKALGDVYRSIARDAAQRHIGMRPWLTLSAAATVTLNSPGGLAVLHRVASE
YHSGHEIQAAELIREVGLKCITFIGVPRIINCLNSFRADLPASVASQLSTRATRTVPLTTAAMVSEQARGRQLWD
SVYAALADKLVAKLALAHPDLPIHIIGCHYAPLLSDPQDSGGGTGEVARTGKVLTEVAAVASLRATQGVGPQVLS
HVYGLQKAWEDESWREGWVGDEAVARWLTGSEGCEWILEKVDGIMHVFAGGNPGPNL*
Coding >OphauB2|1425
ATGCCGACACTCTCTCCCTCGCTCAAGGCGCTCATCAAGGCGCCCTTTGCGCATCCCAATCCCGCCGCCCCGCCC
AAGGCCCTCGGAGACGTCTATCGCAGCATTGCTCGCGATGCAGCTCAGCGACATATAGGCATGAGGCCGTGGTTG
ACCTTGTCGGCAGCCGCAACGGTTACTCTCAACTCGCCCGGTGGCCTCGCAGTGCTGCATCGAGTAGCAAGCGAG
TATCACAGCGGCCACGAAATCCAGGCCGCCGAGCTGATTCGCGAAGTCGGTCTCAAATGCATAACCTTTATCGGC
GTGCCGCGCATCATCAACTGCCTCAACAGCTTCCGCGCCGACCTCCCAGCCTCTGTGGCCAGCCAGCTCTCCACG
CGCGCCACGCGCACCGTTCCCCTCACCACGGCAGCCATGGTAAGCGAGCAGGCGCGCGGCAGGCAGCTGTGGGAC
TCGGTATACGCGGCGCTGGCGGACAAGCTGGTGGCCAAGCTGGCGCTGGCGCACCCAGACCTGCCCATTCACATT
ATTGGCTGCCACTATGCGCCGCTGCTATCGGATCCCCAGGATAGCGGCGGGGGCACAGGCGAGGTGGCGAGGACG
GGAAAAGTCTTGACCGAGGTGGCGGCGGTGGCTAGTCTGCGGGCAACGCAGGGCGTGGGACCGCAGGTGCTGTCG
CATGTCTACGGCTTGCAAAAGGCGTGGGAGGATGAGTCGTGGAGGGAGGGTTGGGTGGGCGATGAAGCGGTGGCG
CGGTGGTTGACGGGGAGTGAGGGCTGTGAGTGGATTCTGGAAAAGGTGGATGGAATAATGCATGTGTTTGCGGGG
GGGAATCCAGGACCCAATCTATGA
Transcript >OphauB2|1425
ATGCCGACACTCTCTCCCTCGCTCAAGGCGCTCATCAAGGCGCCCTTTGCGCATCCCAATCCCGCCGCCCCGCCC
AAGGCCCTCGGAGACGTCTATCGCAGCATTGCTCGCGATGCAGCTCAGCGACATATAGGCATGAGGCCGTGGTTG
ACCTTGTCGGCAGCCGCAACGGTTACTCTCAACTCGCCCGGTGGCCTCGCAGTGCTGCATCGAGTAGCAAGCGAG
TATCACAGCGGCCACGAAATCCAGGCCGCCGAGCTGATTCGCGAAGTCGGTCTCAAATGCATAACCTTTATCGGC
GTGCCGCGCATCATCAACTGCCTCAACAGCTTCCGCGCCGACCTCCCAGCCTCTGTGGCCAGCCAGCTCTCCACG
CGCGCCACGCGCACCGTTCCCCTCACCACGGCAGCCATGGTAAGCGAGCAGGCGCGCGGCAGGCAGCTGTGGGAC
TCGGTATACGCGGCGCTGGCGGACAAGCTGGTGGCCAAGCTGGCGCTGGCGCACCCAGACCTGCCCATTCACATT
ATTGGCTGCCACTATGCGCCGCTGCTATCGGATCCCCAGGATAGCGGCGGGGGCACAGGCGAGGTGGCGAGGACG
GGAAAAGTCTTGACCGAGGTGGCGGCGGTGGCTAGTCTGCGGGCAACGCAGGGCGTGGGACCGCAGGTGCTGTCG
CATGTCTACGGCTTGCAAAAGGCGTGGGAGGATGAGTCGTGGAGGGAGGGTTGGGTGGGCGATGAAGCGGTGGCG
CGGTGGTTGACGGGGAGTGAGGGCTGTGAGTGGATTCTGGAAAAGGTGGATGGAATAATGCATGTGTTTGCGGGG
GGGAATCCAGGACCCAATCTATGA
Gene >OphauB2|1425
ATGCCGACACTCTCTCCCTCGCTCAAGGCGCTCATCAAGGCGCCCTTTGCGCATCCCAATCCCGCCGCCCCGCCC
AAGGCCCTCGGAGACGTCTATCGCAGCATTGCTCGCGATGCAGCTCAGCGACATATAGGCATGAGGCCGTGGTTG
ACCTTGTCGGTATGAAACATTCTAACCCATGCTCCTGGACTCGCGTGAAACGAGGCTAACGTGTATGCCAACAGG
CAGCCGCAACGGTTACTCTCAACTCGCCCGGTGGCCTCGCAGTGCTGCATCGAGTAGCAAGCGAGTATCACAGCG
GCCACGAAATCCAGGCCGCCGAGCTGATTCGCGAAGTCGGTCTCAAATGCATAACCTTTATCGGCGTGCCGCGCA
TCATCAACTGCCTCAACAGCTTCCGCGCCGACCTCCCAGCCTCTGTGGCCAGCCAGCTCTCCACGCGCGCCACGC
GCACCGTTCCCCTCACCACGGCAGCCATGGTAAGCGAGCAGGCGCGCGGCAGGCAGCTGTGGGACTCGGTATACG
CGGCGCTGGCGGACAAGCTGGTGGCCAAGCTGGCGCTGGCGCACCCAGACCTGCCCATTCACATTATTGGCTGCC
ACTATGCGCCGCTGCTATCGGATCCCCAGGATAGCGGCGGGGGCACAGGCGAGGTGGCGAGGACGGGAAAAGTCT
TGACCGAGGTGGCGGCGGTGGCTAGTCTGCGGGCAACGCAGGGCGTGGGACCGCAGGTGCTGTCGCATGTCTACG
GCTTGCAAAAGGCGTGGGAGGATGAGTCGTGGAGGGAGGGTTGGGTGGGCGATGAAGCGGTGGCGCGGTGGTTGA
CGGGGAGTGAGGGCTGTGAGTGGATTCTGGAAAAGGTGGATGGAATAATGCATGTGTTTGCGGGGGGGAATCCAG
GACCCAATCTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail