Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1421
Gene name
LocationContig_138:13275..14953
Strand+
Gene length (bp)1678
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04104 DNA_primase_lrg Eukaryotic and archaeal DNA primase, large subunit 2.7E-84 195 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIZ4|PRI2_NEUCR Probable DNA primase large subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=5F3.150 PE=3 SV=1 1 498 0.0E+00
sp|O74761|PRI2_SCHPO DNA primase large subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri2 PE=1 SV=1 1 482 6.0E-148
sp|P20457|PRI2_YEAST DNA primase large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI2 PE=1 SV=1 34 482 3.0E-100
sp|Q84WJ2|PRI2_ARATH Probable DNA primase large subunit OS=Arabidopsis thaliana GN=At1g67320 PE=2 SV=2 38 482 5.0E-88
sp|P33610|PRI2_MOUSE DNA primase large subunit OS=Mus musculus GN=Prim2 PE=1 SV=1 20 497 3.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NIZ4|PRI2_NEUCR Probable DNA primase large subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=5F3.150 PE=3 SV=1 1 498 0.0E+00
sp|O74761|PRI2_SCHPO DNA primase large subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri2 PE=1 SV=1 1 482 6.0E-148
sp|P20457|PRI2_YEAST DNA primase large subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI2 PE=1 SV=1 34 482 3.0E-100
sp|Q84WJ2|PRI2_ARATH Probable DNA primase large subunit OS=Arabidopsis thaliana GN=At1g67320 PE=2 SV=2 38 482 5.0E-88
sp|P33610|PRI2_MOUSE DNA primase large subunit OS=Mus musculus GN=Prim2 PE=1 SV=1 20 497 3.0E-82
sp|O89044|PRI2_RAT DNA primase large subunit OS=Rattus norvegicus GN=Prim2 PE=2 SV=1 20 498 4.0E-80
sp|P49643|PRI2_HUMAN DNA primase large subunit OS=Homo sapiens GN=PRIM2 PE=1 SV=2 20 497 4.0E-80
sp|Q9VPH2|PRI2_DROME DNA primase large subunit OS=Drosophila melanogaster GN=DNApol-alpha60 PE=1 SV=2 31 484 6.0E-56
sp|O02334|PRI2_CAEEL DNA primase large subunit OS=Caenorhabditis elegans GN=pri-2 PE=3 SV=2 6 482 6.0E-50
sp|Q55BM5|PRI2_DICDI DNA primase large subunit OS=Dictyostelium discoideum GN=prim2 PE=3 SV=1 41 495 1.0E-40
[Show less]

GO

GO Term Description Terminal node
GO:0006269 DNA replication, synthesis of RNA primer Yes
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1421
MLRHDSNRIDPKRRNVIDHRKKQFASPQYKETDYPHRLNYYTDAPTAEITLEQFEQWAIDRLRVLGEIEACSFRN
RTPTETALHMKPILDKYLPLDTNSSASSNLFSQRQKDHYSHFILRLAFSMTDDLRRRFTRVETMLFRMRFANDDL
AERSAFVQSLNLGWCEAVPEAERQSLALELMALSSKKGSYDQDAWFKVDWERVPDLVEQRRVLLKFGKAYVPERE
QSSMVVAEFAARLEKQLGLTARALPRLDEDDRLTPILNHLSKNFITPDSAYMSDSAPAGAQPSAANIDQLSQHFP
ACMKHLHQTLRRDAHLKHYGRLQYTLFLKGIGLNLEECLVFWRSSFSKITDDTFNKEYRYNVRHSYGDVGGDANR
RGGGYSPMSCQKILTEHPPGPGEAHGCPYRHFDMENLTTLLGSMGVTDRAVLQGVKEDKDSQKFHMACNRVFEHL
HKAEIKTAKDQGVMTTNQLETIVHPNEYYKRSYLLKTLDTKEDVKAEG*
Coding >OphauB2|1421
ATGTTGCGGCACGACTCTAACCGCATCGACCCCAAGCGGCGCAACGTCATTGACCACCGCAAGAAGCAGTTTGCC
TCTCCCCAGTACAAAGAGACAGATTATCCCCACCGCCTCAACTACTACACGGATGCGCCAACGGCCGAAATCACG
CTCGAGCAGTTTGAGCAATGGGCCATTGACAGGCTGAGAGTTCTCGGCGAAATCGAAGCCTGTTCTTTTCGCAAC
AGGACGCCAACTGAAACCGCCCTTCACATGAAGCCCATACTCGACAAATACCTGCCCCTCGACACCAACAGCTCG
GCCTCTTCAAACTTGTTTTCCCAGCGGCAAAAGGATCACTATAGTCACTTTATTCTGCGGCTGGCCTTTTCCATG
ACGGACGACTTGCGCCGACGCTTTACCCGCGTCGAGACGATGCTTTTCCGCATGCGCTTTGCCAATGACGATCTT
GCCGAGCGCTCTGCATTTGTCCAAAGCTTGAATCTGGGCTGGTGCGAGGCTGTCCCCGAGGCCGAGAGACAGTCG
CTGGCTCTAGAGCTCATGGCCCTGTCCTCCAAAAAGGGCAGCTATGACCAAGACGCTTGGTTCAAGGTGGATTGG
GAAAGGGTTCCGGATCTCGTTGAGCAGCGTCGTGTCTTGCTCAAGTTTGGCAAGGCCTATGTACCCGAACGCGAG
CAGTCAAGCATGGTGGTGGCAGAGTTTGCTGCGCGGCTCGAGAAGCAGCTCGGGCTTACGGCGCGCGCACTTCCA
CGCCTCGACGAGGACGACCGCCTGACTCCCATTCTTAACCACTTGTCCAAAAACTTTATTACGCCCGACTCGGCC
TACATGTCCGACTCGGCGCCCGCTGGTGCTCAGCCGTCAGCCGCAAACATTGACCAATTGTCCCAACACTTCCCA
GCCTGTATGAAGCATTTGCATCAGACGCTGCGGCGCGATGCCCATCTCAAGCATTATGGGCGTCTGCAGTACACC
CTCTTCCTCAAGGGAATCGGGCTCAACCTCGAAGAGTGTCTTGTATTCTGGCGGAGTAGCTTTTCAAAAATTACC
GACGACACCTTCAACAAGGAGTACCGCTACAATGTTCGTCACAGCTACGGCGACGTGGGTGGCGACGCAAACCGC
AGAGGCGGCGGCTACAGCCCCATGAGCTGCCAAAAGATCTTGACGGAGCATCCGCCAGGTCCGGGAGAGGCCCAC
GGATGTCCATACCGCCACTTTGACATGGAAAATCTGACGACGCTTCTTGGCTCCATGGGCGTGACGGACCGCGCA
GTCCTGCAGGGAGTCAAGGAAGACAAGGACAGCCAAAAATTCCACATGGCATGCAACAGAGTCTTTGAGCATCTG
CACAAGGCCGAAATTAAAACGGCCAAGGACCAAGGTGTAATGACGACTAATCAGCTCGAGACTATTGTCCATCCC
AACGAGTACTACAAGCGGAGTTATCTGCTCAAAACCCTTGACACTAAAGAGGACGTCAAGGCCGAGGGATAA
Transcript >OphauB2|1421
ATGTTGCGGCACGACTCTAACCGCATCGACCCCAAGCGGCGCAACGTCATTGACCACCGCAAGAAGCAGTTTGCC
TCTCCCCAGTACAAAGAGACAGATTATCCCCACCGCCTCAACTACTACACGGATGCGCCAACGGCCGAAATCACG
CTCGAGCAGTTTGAGCAATGGGCCATTGACAGGCTGAGAGTTCTCGGCGAAATCGAAGCCTGTTCTTTTCGCAAC
AGGACGCCAACTGAAACCGCCCTTCACATGAAGCCCATACTCGACAAATACCTGCCCCTCGACACCAACAGCTCG
GCCTCTTCAAACTTGTTTTCCCAGCGGCAAAAGGATCACTATAGTCACTTTATTCTGCGGCTGGCCTTTTCCATG
ACGGACGACTTGCGCCGACGCTTTACCCGCGTCGAGACGATGCTTTTCCGCATGCGCTTTGCCAATGACGATCTT
GCCGAGCGCTCTGCATTTGTCCAAAGCTTGAATCTGGGCTGGTGCGAGGCTGTCCCCGAGGCCGAGAGACAGTCG
CTGGCTCTAGAGCTCATGGCCCTGTCCTCCAAAAAGGGCAGCTATGACCAAGACGCTTGGTTCAAGGTGGATTGG
GAAAGGGTTCCGGATCTCGTTGAGCAGCGTCGTGTCTTGCTCAAGTTTGGCAAGGCCTATGTACCCGAACGCGAG
CAGTCAAGCATGGTGGTGGCAGAGTTTGCTGCGCGGCTCGAGAAGCAGCTCGGGCTTACGGCGCGCGCACTTCCA
CGCCTCGACGAGGACGACCGCCTGACTCCCATTCTTAACCACTTGTCCAAAAACTTTATTACGCCCGACTCGGCC
TACATGTCCGACTCGGCGCCCGCTGGTGCTCAGCCGTCAGCCGCAAACATTGACCAATTGTCCCAACACTTCCCA
GCCTGTATGAAGCATTTGCATCAGACGCTGCGGCGCGATGCCCATCTCAAGCATTATGGGCGTCTGCAGTACACC
CTCTTCCTCAAGGGAATCGGGCTCAACCTCGAAGAGTGTCTTGTATTCTGGCGGAGTAGCTTTTCAAAAATTACC
GACGACACCTTCAACAAGGAGTACCGCTACAATGTTCGTCACAGCTACGGCGACGTGGGTGGCGACGCAAACCGC
AGAGGCGGCGGCTACAGCCCCATGAGCTGCCAAAAGATCTTGACGGAGCATCCGCCAGGTCCGGGAGAGGCCCAC
GGATGTCCATACCGCCACTTTGACATGGAAAATCTGACGACGCTTCTTGGCTCCATGGGCGTGACGGACCGCGCA
GTCCTGCAGGGAGTCAAGGAAGACAAGGACAGCCAAAAATTCCACATGGCATGCAACAGAGTCTTTGAGCATCTG
CACAAGGCCGAAATTAAAACGGCCAAGGACCAAGGTGTAATGACGACTAATCAGCTCGAGACTATTGTCCATCCC
AACGAGTACTACAAGCGGAGTTATCTGCTCAAAACCCTTGACACTAAAGAGGACGTCAAGGCCGAGGGATAA
Gene >OphauB2|1421
ATGTTGCGGCACGACTCTAACCGCATCGACCCCAAGCGGCGCAACGTCATTGACCACCGCAAGAAGCAGTTTGCC
TCTCCCCAGTACAAAGAGACAGATTATCCCCACCGCCTCAACTACTACACGGATGCGCCAACGGCCGAAATCACG
CTCGAGCAGTTTGAGCAATGGGCCATTGACAGGCTGAGAGGTTTGCTTTTAGCCCCTCTGTGTCTGTGCAATGCT
GACTCTGCCGCCAGTTCTCGGCGAAATCGAAGCCTGTTCTTTTCGCAACAGGACGCCAACTGAAACCGCCCTTCA
CATGAAGCCCATACTCGACAAATACCTGCCCCTCGACACCAACAGCTCGGCCTCTTCAAACTTGTTTTCCCAGCG
GCAAAAGGATCACTATAGTCACTTTATTCTGCGGCTGGCCTTTTCCATGACGGACGACTTGCGCCGACGCTTTAC
CCGCGTCGAGACGATGCTTTTCCGCATGCGCTTTGCCAATGACGATCTTGCCGAGCGCTCTGCATTTGTCCAAAG
CTTGAATCTGGGCTGGTGCGAGGCTGTCCCCGAGGCCGAGAGACAGTCGCTGGCTCTAGAGCTCATGGCCCTGTC
CTCCAAAAAGGGCAGCTATGACCAAGACGCTTGGTTCAAGGTGGATTGGGAAAGGGTTCCGGATCTCGTTGAGCA
GCGTCGTGTCTTGCTCAAGTTTGGCAAGGCCTATGTACCCGAACGCGAGCAGTCAAGCATGGTGGTGGCAGAGTT
TGCTGCGCGGCTCGAGAAGCAGCTCGGGGTGAGTAGACGAGTGTTGCAGTGTCGAGAACAAGGCTGATGCATCGT
CCACACGGCACAGCTTACGGCGCGCGCACTTCCACGCCTCGACGAGGACGACCGCCTGACTCCCATTCTTAACCA
CTTGTCCAAAAACTTTATTACGCCCGACTCGGCCTACATGTCCGACTCGGCGCCCGCTGGTGCTCAGCCGTCAGC
CGCAAACATTGACCAATTGTCCCAACACTTCCCAGCCTGTATGAAGCATTTGCATCAGACGCTGCGGCGCGATGC
CCATCTCAAGCATTATGGGCGTCTGCAGTACACCCTCTTCCTCAAGGGAATCGGGCTCAACCTCGAAGAGTGTCT
TGTATTCTGGCGGAGTAGCTTTTCAAAAATTACCGACGACACCTTCAACAAGGAGTACCGCTACAATGTTCGTCA
CAGCTACGGCGACGTGGGTGGCGACGCAAACCGCAGAGGCGGCGGCTACAGCCCCATGAGCTGCCAAAAGATCTT
GACGGAGCATCCGCCAGGTCCGGGAGAGGCCCACGGATGTCCATACCGCCACTTTGACATGGAAAATCTGACGAC
GCTTCTTGGCTCCATGGGCGTGACGGACCGCGCAGTCCTGCAGGGAGTCAAGGAAGACAAGGACAGCCAAAAATT
CCACATGGCATGCAACAGGCAAGTCGTCTCGCCCAAGACTGCTATTGAATTTGACTCTTTGCTAACTCTTTTCTT
TTTGTCCGAGAGCAGAGTCTTTGAGCATCTGCACAAGGCCGAAATTAAAACGGCCAAGGACCAAGGTGTAATGAC
GACTAATCAGCTCGAGACTATTGTCCATCCCAACGAGTACTACAAGCGGAGTTATCTGCTCAAAACCCTTGACAC
TAAAGAGGACGTCAAGGCCGAGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail