Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1414
Gene name
LocationContig_137:41055..43469
Strand+
Gene length (bp)2414
Transcript length (bp)2274
Coding sequence length (bp)2274
Protein length (aa) 758

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03999 MAP65_ASE1 Microtubule associated protein (MAP65/ASE1 family) 1.8E-75 14 509

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HDY1|ASE1_SCHPO Anaphase spindle elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ase1 PE=1 SV=1 13 576 2.0E-59
sp|Q99K43|PRC1_MOUSE Protein regulator of cytokinesis 1 OS=Mus musculus GN=Prc1 PE=1 SV=2 225 559 6.0E-26
sp|O43663|PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo sapiens GN=PRC1 PE=1 SV=2 225 529 5.0E-25
sp|P50275|ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASE1 PE=1 SV=1 174 473 2.0E-24
sp|Q9LZY0|MA654_ARATH 65-kDa microtubule-associated protein 4 OS=Arabidopsis thaliana GN=MAP65-4 PE=1 SV=2 15 457 3.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7545
Ophiocordyceps australis map64 (Brazil) OphauB2|1414 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06003
Ophiocordyceps camponoti-rufipedis Ophun1|412
Ophiocordyceps kimflemingae Ophio5|6174
Ophiocordyceps subramaniannii Hirsu2|6692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1414
MDNSSSLAQQVNSSISQLHDLLDEIGVAPHEREAREAELFEALSDALNNQVRLVTSEKKQLVDEAKKTITAIRQM
DASLGDARPSRRPFLDDDFKITYPLTRCLELLHEKLAQVSQLHGERAEQVMKLVEALLSYSSHLEPTFVKIELPP
TDGKTPFPPTFDMSPSYIDRLDAEFTRVYEEYTRRIATVQALSNSIIQLWAELGVPQSQQDGAIVKYYRDAPEQL
GLHQEDVARLQSLCDRLVSEKKNREKRLRDLRAAVQSLWEKLGINEAETKAFVNQNRGYGVRQINEYEDELARLN
ELKHQNLHVFVEDARIRLQDLWDALYLSEDEMLEFTPAFSDVYSDALLEAHEQEVARLEALQEQRAPLLALVDKH
RSLIHDRDELAASSQDASRLMMRGQKGEKRDPGKLLREEKMRKRIAKELPRVAAEVRKALNKWEDEYDRPFLVHG
ERYLDALEAEESKNAAPATRSRTPAGPPPSTSKAAPKPAGLSRANSARSIPSRSMTKTPMGAGSSTSTTSSNRHV
RPQSQNAMLSSRSSPSRIPARVPLSNLKHGNNSPERRRPESRGEMVRQGASMRAPPPKMRDLRPVPELQTPGNPY
KTISGIVRPVEPEDVFDDGHAAVAMRSQSTLSHYTQRSSLEDRSGHSTLRGAHDARGFYSQAPPRQISNTSSHTS
ATVSENWETYDDVSEPEPDASETYYAKLRAARSKRLDADTESQAQRSRGIPPPAGYKGPVMIDQDGNRILSGSEW
TDEDAVC*
Coding >OphauB2|1414
ATGGACAATAGCAGCTCTCTGGCCCAGCAGGTCAATAGCAGCATTAGCCAGCTGCATGACCTTTTGGACGAGATT
GGCGTCGCGCCTCATGAGCGTGAGGCGCGCGAGGCAGAGCTTTTCGAGGCTCTGTCGGATGCGCTCAATAACCAG
GTGCGTCTGGTGACGTCGGAGAAGAAGCAATTGGTGGATGAGGCCAAAAAGACGATTACCGCGATTCGCCAAATG
GACGCGTCGCTCGGCGATGCGAGGCCGTCGCGAAGACCCTTTCTCGATGATGATTTCAAAATCACATATCCCTTG
ACGCGTTGTCTTGAGCTTCTCCACGAAAAGCTTGCGCAAGTGAGCCAGCTGCACGGAGAGCGCGCCGAGCAGGTC
ATGAAGCTCGTCGAAGCACTCTTGTCGTACTCGTCGCATCTTGAGCCGACTTTTGTCAAGATTGAACTTCCTCCC
ACCGATGGCAAGACGCCATTTCCGCCCACGTTTGACATGTCGCCCTCTTATATAGACCGTCTTGATGCCGAGTTT
ACGCGAGTCTATGAAGAATACACACGGCGCATAGCAACCGTCCAGGCCTTGTCTAACAGCATTATTCAGCTCTGG
GCCGAGTTGGGCGTGCCTCAGTCGCAGCAGGACGGTGCCATTGTCAAGTACTATCGCGACGCTCCCGAGCAGCTG
GGGCTGCACCAGGAAGACGTGGCCCGGCTGCAGTCGCTGTGCGACCGCCTGGTGAGCGAAAAGAAGAATCGAGAG
AAGCGGCTGCGCGACTTGCGCGCCGCTGTCCAGAGCCTGTGGGAAAAGCTGGGCATCAACGAGGCCGAGACCAAG
GCCTTTGTCAACCAGAACCGCGGGTATGGCGTGCGTCAAATCAATGAATATGAAGACGAACTGGCCCGGCTCAAT
GAGCTCAAGCATCAAAACCTGCACGTCTTTGTTGAAGATGCGCGCATCCGGCTCCAGGATTTGTGGGATGCGCTC
TACTTGTCCGAAGACGAGATGCTCGAGTTTACGCCAGCCTTTTCCGATGTCTACAGCGATGCTTTGCTCGAGGCC
CATGAACAAGAAGTGGCGCGCCTTGAGGCTCTGCAAGAGCAGCGGGCGCCACTGCTTGCCCTGGTCGACAAGCAC
CGGTCGCTGATTCATGATCGTGACGAGCTGGCAGCGTCTAGCCAGGATGCCTCGCGGCTCATGATGCGCGGCCAA
AAGGGCGAGAAGAGAGACCCGGGAAAGCTGTTGCGCGAGGAAAAGATGCGCAAGCGGATAGCAAAGGAGCTTCCG
CGCGTGGCGGCAGAGGTGCGCAAAGCGCTCAACAAGTGGGAAGATGAATATGACCGGCCATTCTTGGTGCATGGG
GAGCGCTATCTCGATGCTCTCGAAGCAGAGGAGAGCAAGAATGCCGCACCGGCAACGCGGTCCAGGACTCCGGCT
GGACCGCCTCCGTCGACGAGCAAAGCAGCGCCTAAGCCGGCAGGTCTTAGCAGGGCCAACAGCGCGCGATCGATT
CCATCGCGATCCATGACCAAGACTCCGATGGGTGCGGGAAGCAGCACCAGCACCACGAGCAGTAATAGACATGTC
CGGCCGCAGTCGCAAAACGCAATGCTTAGCAGCAGAAGCAGTCCATCGAGGATTCCTGCGCGCGTGCCGCTGAGC
AACCTCAAGCACGGCAACAACTCGCCGGAGCGACGACGGCCAGAGTCGAGGGGCGAAATGGTGCGTCAGGGCGCT
TCTATGCGTGCGCCGCCGCCCAAGATGCGCGACTTGCGGCCCGTGCCAGAGCTGCAGACGCCGGGGAATCCATAC
AAGACGATATCGGGCATAGTGCGGCCCGTGGAGCCCGAGGATGTCTTTGACGACGGTCACGCGGCGGTGGCGATG
CGCTCCCAGTCGACCCTGTCGCACTATACGCAGCGCAGCTCTCTCGAGGATCGAAGTGGCCACTCAACGCTTCGC
GGCGCCCATGACGCCAGGGGATTCTACTCGCAGGCGCCACCGCGTCAAATCTCAAATACATCGTCACACACGTCG
GCGACTGTGTCTGAGAACTGGGAAACGTACGACGATGTGAGCGAGCCGGAGCCAGATGCGTCCGAGACGTATTAT
GCCAAGCTGCGGGCGGCACGGAGCAAGCGCCTCGATGCCGACACGGAGAGCCAGGCGCAGCGCTCGCGCGGCATT
CCTCCTCCTGCCGGGTACAAGGGCCCAGTCATGATTGACCAAGATGGCAACAGAATCCTGTCTGGCAGCGAGTGG
ACCGACGAGGATGCCGTCTGCTAG
Transcript >OphauB2|1414
ATGGACAATAGCAGCTCTCTGGCCCAGCAGGTCAATAGCAGCATTAGCCAGCTGCATGACCTTTTGGACGAGATT
GGCGTCGCGCCTCATGAGCGTGAGGCGCGCGAGGCAGAGCTTTTCGAGGCTCTGTCGGATGCGCTCAATAACCAG
GTGCGTCTGGTGACGTCGGAGAAGAAGCAATTGGTGGATGAGGCCAAAAAGACGATTACCGCGATTCGCCAAATG
GACGCGTCGCTCGGCGATGCGAGGCCGTCGCGAAGACCCTTTCTCGATGATGATTTCAAAATCACATATCCCTTG
ACGCGTTGTCTTGAGCTTCTCCACGAAAAGCTTGCGCAAGTGAGCCAGCTGCACGGAGAGCGCGCCGAGCAGGTC
ATGAAGCTCGTCGAAGCACTCTTGTCGTACTCGTCGCATCTTGAGCCGACTTTTGTCAAGATTGAACTTCCTCCC
ACCGATGGCAAGACGCCATTTCCGCCCACGTTTGACATGTCGCCCTCTTATATAGACCGTCTTGATGCCGAGTTT
ACGCGAGTCTATGAAGAATACACACGGCGCATAGCAACCGTCCAGGCCTTGTCTAACAGCATTATTCAGCTCTGG
GCCGAGTTGGGCGTGCCTCAGTCGCAGCAGGACGGTGCCATTGTCAAGTACTATCGCGACGCTCCCGAGCAGCTG
GGGCTGCACCAGGAAGACGTGGCCCGGCTGCAGTCGCTGTGCGACCGCCTGGTGAGCGAAAAGAAGAATCGAGAG
AAGCGGCTGCGCGACTTGCGCGCCGCTGTCCAGAGCCTGTGGGAAAAGCTGGGCATCAACGAGGCCGAGACCAAG
GCCTTTGTCAACCAGAACCGCGGGTATGGCGTGCGTCAAATCAATGAATATGAAGACGAACTGGCCCGGCTCAAT
GAGCTCAAGCATCAAAACCTGCACGTCTTTGTTGAAGATGCGCGCATCCGGCTCCAGGATTTGTGGGATGCGCTC
TACTTGTCCGAAGACGAGATGCTCGAGTTTACGCCAGCCTTTTCCGATGTCTACAGCGATGCTTTGCTCGAGGCC
CATGAACAAGAAGTGGCGCGCCTTGAGGCTCTGCAAGAGCAGCGGGCGCCACTGCTTGCCCTGGTCGACAAGCAC
CGGTCGCTGATTCATGATCGTGACGAGCTGGCAGCGTCTAGCCAGGATGCCTCGCGGCTCATGATGCGCGGCCAA
AAGGGCGAGAAGAGAGACCCGGGAAAGCTGTTGCGCGAGGAAAAGATGCGCAAGCGGATAGCAAAGGAGCTTCCG
CGCGTGGCGGCAGAGGTGCGCAAAGCGCTCAACAAGTGGGAAGATGAATATGACCGGCCATTCTTGGTGCATGGG
GAGCGCTATCTCGATGCTCTCGAAGCAGAGGAGAGCAAGAATGCCGCACCGGCAACGCGGTCCAGGACTCCGGCT
GGACCGCCTCCGTCGACGAGCAAAGCAGCGCCTAAGCCGGCAGGTCTTAGCAGGGCCAACAGCGCGCGATCGATT
CCATCGCGATCCATGACCAAGACTCCGATGGGTGCGGGAAGCAGCACCAGCACCACGAGCAGTAATAGACATGTC
CGGCCGCAGTCGCAAAACGCAATGCTTAGCAGCAGAAGCAGTCCATCGAGGATTCCTGCGCGCGTGCCGCTGAGC
AACCTCAAGCACGGCAACAACTCGCCGGAGCGACGACGGCCAGAGTCGAGGGGCGAAATGGTGCGTCAGGGCGCT
TCTATGCGTGCGCCGCCGCCCAAGATGCGCGACTTGCGGCCCGTGCCAGAGCTGCAGACGCCGGGGAATCCATAC
AAGACGATATCGGGCATAGTGCGGCCCGTGGAGCCCGAGGATGTCTTTGACGACGGTCACGCGGCGGTGGCGATG
CGCTCCCAGTCGACCCTGTCGCACTATACGCAGCGCAGCTCTCTCGAGGATCGAAGTGGCCACTCAACGCTTCGC
GGCGCCCATGACGCCAGGGGATTCTACTCGCAGGCGCCACCGCGTCAAATCTCAAATACATCGTCACACACGTCG
GCGACTGTGTCTGAGAACTGGGAAACGTACGACGATGTGAGCGAGCCGGAGCCAGATGCGTCCGAGACGTATTAT
GCCAAGCTGCGGGCGGCACGGAGCAAGCGCCTCGATGCCGACACGGAGAGCCAGGCGCAGCGCTCGCGCGGCATT
CCTCCTCCTGCCGGGTACAAGGGCCCAGTCATGATTGACCAAGATGGCAACAGAATCCTGTCTGGCAGCGAGTGG
ACCGACGAGGATGCCGTCTGCTAG
Gene >OphauB2|1414
ATGGACAATAGCAGCTCTCTGGCCCAGCAGGTCAATAGCAGCATTAGCCAGCTGCATGACCTTTTGGACGAGATT
GGCGTCGCGCCTCATGAGCGTGAGGCGCGCGAGGCAGAGGTGCGTCTTGGAGTCGTTGCGTCTTTTTGCTGCCTG
CAATTGAGCGCGGTGCATCTAACTCGCCGTGGTGCCATGACTAGCTTTTCGAGGCTCTGTCGGATGCGCTCAATA
ACCAGGTGCGTCTGGTGACGTCGGAGAAGAAGCAATTGGTGGATGAGGCCAAAAAGACGATTACCGCGATTCGCC
AAATGGACGCGTCGCTCGGCGATGCGAGGCCGTCGCGAAGACCCTTTCTCGATGATGATTTCAAAATCACATATC
CCTTGACGCGTTGTCTTGAGCTTCTCCACGAAAAGCTTGCGCAAGTGAGCCAGCTGCACGGAGAGCGCGCCGAGC
AGGTCATGAGTCAGTTGCACGGCACCTTGTCTGCAGACTGGCACCAAGTGGCTAATTTTTTGCGCGCAGAGCTCG
TCGAAGCACTCTTGTCGTACTCGTCGCATCTTGAGCCGACTTTTGTCAAGATTGAACTTCCTCCCACCGATGGCA
AGACGCCATTTCCGCCCACGTTTGACATGTCGCCCTCTTATATAGACCGTCTTGATGCCGAGTTTACGCGAGTCT
ATGAAGAATACACACGGCGCATAGCAACCGTCCAGGCCTTGTCTAACAGCATTATTCAGCTCTGGGCCGAGTTGG
GCGTGCCTCAGTCGCAGCAGGACGGTGCCATTGTCAAGTACTATCGCGACGCTCCCGAGCAGCTGGGGCTGCACC
AGGAAGACGTGGCCCGGCTGCAGTCGCTGTGCGACCGCCTGGTGAGCGAAAAGAAGAATCGAGAGAAGCGGCTGC
GCGACTTGCGCGCCGCTGTCCAGAGCCTGTGGGAAAAGCTGGGCATCAACGAGGCCGAGACCAAGGCCTTTGTCA
ACCAGAACCGCGGGTATGGCGTGCGTCAAATCAATGAATATGAAGACGAACTGGCCCGGCTCAATGAGCTCAAGC
ATCAAAACCTGCACGTCTTTGTTGAAGATGCGCGCATCCGGCTCCAGGATTTGTGGGATGCGCTCTACTTGTCCG
AAGACGAGATGCTCGAGTTTACGCCAGCCTTTTCCGATGTCTACAGCGATGCTTTGCTCGAGGCCCATGAACAAG
AAGTGGCGCGCCTTGAGGCTCTGCAAGAGCAGCGGGCGCCACTGCTTGCCCTGGTCGACAAGCACCGGTCGCTGA
TTCATGATCGTGACGAGCTGGCAGCGTCTAGCCAGGATGCCTCGCGGCTCATGATGCGCGGCCAAAAGGGCGAGA
AGAGAGACCCGGGAAAGCTGTTGCGCGAGGAAAAGATGCGCAAGCGGATAGCAAAGGAGCTTCCGCGCGTGGCGG
CAGAGGTGCGCAAAGCGCTCAACAAGTGGGAAGATGAATATGACCGGCCATTCTTGGTGCATGGGGAGCGCTATC
TCGATGCTCTCGAAGCAGAGGAGAGCAAGAATGCCGCACCGGCAACGCGGTCCAGGACTCCGGCTGGACCGCCTC
CGTCGACGAGCAAAGCAGCGCCTAAGCCGGCAGGTCTTAGCAGGGCCAACAGCGCGCGATCGATTCCATCGCGAT
CCATGACCAAGACTCCGATGGGTGCGGGAAGCAGCACCAGCACCACGAGCAGTAATAGACATGTCCGGCCGCAGT
CGCAAAACGCAATGCTTAGCAGCAGAAGCAGTCCATCGAGGATTCCTGCGCGCGTGCCGCTGAGCAACCTCAAGC
ACGGCAACAACTCGCCGGAGCGACGACGGCCAGAGTCGAGGGGCGAAATGGTGCGTCAGGGCGCTTCTATGCGTG
CGCCGCCGCCCAAGATGCGCGACTTGCGGCCCGTGCCAGAGCTGCAGACGCCGGGGAATCCATACAAGACGATAT
CGGGCATAGTGCGGCCCGTGGAGCCCGAGGATGTCTTTGACGACGGTCACGCGGCGGTGGCGATGCGCTCCCAGT
CGACCCTGTCGCACTATACGCAGCGCAGCTCTCTCGAGGATCGAAGTGGCCACTCAACGCTTCGCGGCGCCCATG
ACGCCAGGGGATTCTACTCGCAGGCGCCACCGCGTCAAATCTCAAATACATCGTCACACACGTCGGCGACTGTGT
CTGAGAACTGGGAAACGTACGACGATGTGAGCGAGCCGGAGCCAGATGCGTCCGAGACGTATTATGCCAAGCTGC
GGGCGGCACGGAGCAAGCGCCTCGATGCCGACACGGAGAGCCAGGCGCAGCGCTCGCGCGGCATTCCTCCTCCTG
CCGGGTACAAGGGCCCAGTCATGATTGACCAAGATGGCAACAGAATCCTGTCTGGCAGCGAGTGGACCGACGAGG
ATGCCGTCTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail