Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1410
Gene name
LocationContig_137:35954..36341
Strand-
Gene length (bp)387
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09044 Kp4 Kp4 8.6E-31 9 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q90121|KP4T_UMV4 KP4 killer toxin OS=Ustilago maydis P4 virus GN=M2A PE=1 SV=1 5 119 5.0E-10

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1410
MKLSITAAMATLRAAAVAGLGINCRGSGLCPSDGAAGNLLNLKAIVDNIQPRSRHYAPGQQIACTGSLCVFYQNG
ASGTAEQTSGFMQALLNHGCKKCGSCPTQPGNDVSKGQLTVNIVGHPQCQGQC*
Coding >OphauB2|1410
ATGAAACTCTCCATCACCGCCGCCATGGCCACTCTCAGGGCCGCCGCCGTCGCCGGCCTCGGCATCAACTGCCGC
GGATCCGGCCTCTGTCCTTCCGACGGCGCCGCCGGCAATCTCCTCAACCTCAAGGCCATTGTCGACAATATCCAA
CCGCGCAGCCGGCACTACGCTCCAGGCCAGCAAATCGCATGCACCGGCTCCCTCTGCGTCTTTTACCAGAACGGC
GCCTCTGGCACTGCCGAGCAGACATCAGGATTTATGCAAGCGCTGCTGAACCATGGCTGCAAAAAGTGTGGTTCG
TGTCCTACGCAGCCAGGAAATGATGTTTCCAAGGGGCAGTTGACGGTGAATATTGTGGGACATCCACAGTGTCAG
GGGCAATGCTAG
Transcript >OphauB2|1410
ATGAAACTCTCCATCACCGCCGCCATGGCCACTCTCAGGGCCGCCGCCGTCGCCGGCCTCGGCATCAACTGCCGC
GGATCCGGCCTCTGTCCTTCCGACGGCGCCGCCGGCAATCTCCTCAACCTCAAGGCCATTGTCGACAATATCCAA
CCGCGCAGCCGGCACTACGCTCCAGGCCAGCAAATCGCATGCACCGGCTCCCTCTGCGTCTTTTACCAGAACGGC
GCCTCTGGCACTGCCGAGCAGACATCAGGATTTATGCAAGCGCTGCTGAACCATGGCTGCAAAAAGTGTGGTTCG
TGTCCTACGCAGCCAGGAAATGATGTTTCCAAGGGGCAGTTGACGGTGAATATTGTGGGACATCCACAGTGTCAG
GGGCAATGCTAG
Gene >OphauB2|1410
ATGAAACTCTCCATCACCGCCGCCATGGCCACTCTCAGGGCCGCCGCCGTCGCCGGCCTCGGCATCAACTGCCGC
GGATCCGGCCTCTGTCCTTCCGACGGCGCCGCCGGCAATCTCCTCAACCTCAAGGCCATTGTCGACAATATCCAA
CCGCGCAGCCGGCACTACGCTCCAGGCCAGCAAATCGCATGCACCGGCTCCCTCTGCGTCTTTTACCAGAACGGC
GCCTCTGGCACTGCCGAGCAGACATCAGGATTTATGCAAGCGCTGCTGAACCATGGCTGCAAAAAGTGTGGTTCG
TGTCCTACGCAGCCAGGAAATGATGTTTCCAAGGGGCAGTTGACGGTGAATATTGTGGGACATCCACAGTGTCAG
GGGCAATGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail