Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1402
Gene name
LocationContig_137:19114..20016
Strand-
Gene length (bp)902
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 8.6E-02 123 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 26 243 5.0E-33
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 32 243 3.0E-22
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 32 243 5.0E-22
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 108 243 6.0E-14
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 4 175 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 26 243 5.0E-33
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 32 243 3.0E-22
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 32 243 5.0E-22
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 108 243 6.0E-14
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 4 175 3.0E-13
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 108 243 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1402
MSSLALLPAILLGTHCLAANALILPRYSTPSLPKASNSAPNCTWWLDYQTERDYQDILNENEITLEQFREWNPTI
TSTGQGLIIGRSYCVEAPSLTPKQPTVAPPLPQAPAPPVPISECTAFHTIQAGDNCWYLMQMYGTFSMPQFQLWN
PDIDETCSRLRPGYRVCVGIQGTPQPRLSIGPQPIQSGVTSNCTKFHKANWRENCLGVASQYKCSIEDFYKWNTA
VLRPCGNFFAGYHYCVSVS*
Coding >OphauB2|1402
ATGTCGTCTCTTGCACTCCTCCCTGCCATACTCCTAGGCACCCACTGCCTAGCTGCCAACGCCCTCATTCTACCT
CGATACTCCACCCCCTCCCTCCCCAAGGCCAGCAACAGCGCTCCAAACTGCACCTGGTGGCTCGACTACCAAACA
GAGCGTGACTACCAAGATATCCTCAACGAGAATGAAATTACTCTCGAGCAATTCCGTGAATGGAATCCCACCATT
ACCTCCACGGGACAAGGCCTCATCATTGGCCGTTCTTACTGCGTCGAAGCTCCTTCATTGACCCCCAAGCAGCCC
ACAGTCGCCCCACCTCTCCCCCAAGCCCCCGCTCCCCCTGTGCCCATCTCCGAATGTACTGCCTTCCACACGATT
CAAGCCGGAGACAATTGCTGGTATCTGATGCAAATGTATGGCACTTTTAGTATGCCTCAGTTTCAACTATGGAAT
CCAGACATCGATGAAACCTGTAGTCGCCTCCGTCCTGGATACCGTGTGTGCGTGGGCATCCAGGGCACGCCGCAG
CCTCGTCTGTCCATTGGCCCCCAGCCTATACAGAGCGGTGTGACGTCAAATTGCACAAAGTTCCACAAGGCAAAT
TGGCGAGAAAATTGTTTGGGCGTTGCCTCTCAGTATAAATGCAGCATAGAAGACTTCTATAAATGGAACACTGCT
GTCCTAAGACCTTGTGGCAACTTCTTCGCGGGCTATCACTACTGCGTGAGCGTCTCGTAA
Transcript >OphauB2|1402
ATGTCGTCTCTTGCACTCCTCCCTGCCATACTCCTAGGCACCCACTGCCTAGCTGCCAACGCCCTCATTCTACCT
CGATACTCCACCCCCTCCCTCCCCAAGGCCAGCAACAGCGCTCCAAACTGCACCTGGTGGCTCGACTACCAAACA
GAGCGTGACTACCAAGATATCCTCAACGAGAATGAAATTACTCTCGAGCAATTCCGTGAATGGAATCCCACCATT
ACCTCCACGGGACAAGGCCTCATCATTGGCCGTTCTTACTGCGTCGAAGCTCCTTCATTGACCCCCAAGCAGCCC
ACAGTCGCCCCACCTCTCCCCCAAGCCCCCGCTCCCCCTGTGCCCATCTCCGAATGTACTGCCTTCCACACGATT
CAAGCCGGAGACAATTGCTGGTATCTGATGCAAATGTATGGCACTTTTAGTATGCCTCAGTTTCAACTATGGAAT
CCAGACATCGATGAAACCTGTAGTCGCCTCCGTCCTGGATACCGTGTGTGCGTGGGCATCCAGGGCACGCCGCAG
CCTCGTCTGTCCATTGGCCCCCAGCCTATACAGAGCGGTGTGACGTCAAATTGCACAAAGTTCCACAAGGCAAAT
TGGCGAGAAAATTGTTTGGGCGTTGCCTCTCAGTATAAATGCAGCATAGAAGACTTCTATAAATGGAACACTGCT
GTCCTAAGACCTTGTGGCAACTTCTTCGCGGGCTATCACTACTGCGTGAGCGTCTCGTAA
Gene >OphauB2|1402
ATGTCGTCTCTTGCACTCCTCCCTGCCATACTCCTAGGCACCCACTGCCTAGCTGCCAACGCCCTCATTCTACCT
CGATACTCCACCCCCTCCCTCCCCAAGGCCAGCAACAGCGCTCCAAACTGCACCTGGTGGCTCGACTACCAAACA
GAGCGTGACTACCAAGATATCCTCAACGAGAATGAAATTACTCTCGAGCAATTCCGTGAATGGGTACTTCACCTC
TTCTACCCCTCTACTCCGTCTACTAACCCTCACAGAATCCCACCATTACCTCCACGGGACAAGGCCTCATCATTG
GCCGTTCTTACTGCGTCGAAGCTCCTTCATTGACCCCCAAGCAGCCCACAGTCGCCCCACCTCTCCCCCAAGCCC
CCGCTCCCCCTGTGCCCATCTCCGAATGTACTGCCTTCCACACGATTCAAGCCGGAGACAATTGCTGGTATCTGA
TGCAAATGTATGGCACTTTTAGTATGCCTCAGTTTCAACTATGGAATCCAGACATCGATGAAACCTGTAGTCGCC
TCCGTCCTGGATACCGTGTGTGCGTGGGCATCCAGGGCACGCCGCAGCCTCGTCTGTCCATTGGCCCCCAGCCTA
TACAGAGCGGTGTGACGTCAAATTGCACAAAGTTCCACAAGGCAAATTGGCGAGAAAATTGTTTGGGCGTTGCCT
CTCAGTATAAATGCAGCATAGAAGACTTGTGAGTATTTTTTCTCGAGTATCGTGTGTCCGTTGCGAAAAGAGGCT
GATGAAGCACAGCTATAAATGGAACACTGCTGTCCTAAGACGTGAGGCAAATATTTCTTCTACTTGAATGAGAAG
TAATGCTAATCATTTTTCGGCTTATAGCTTGTGGCAACTTCTTCGCGGGCTATCACTACTGCGTGAGCGTCTCGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail