Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1389
Gene name
LocationContig_136:29921..30957
Strand-
Gene length (bp)1036
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 6.6E-21 29 240
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.0E-11 38 183
PF08659 KR KR domain 4.1E-07 31 121
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.2E-07 31 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 277 4.0E-33
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 8 322 5.0E-28
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 8 250 2.0E-27
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 26 316 4.0E-25
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 26 240 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 16 277 4.0E-33
sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 8 322 5.0E-28
sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 8 250 2.0E-27
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 26 316 4.0E-25
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 26 240 1.0E-24
sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 8 322 1.0E-23
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 25 300 2.0E-20
sp|Q9ERI6|RDH14_MOUSE Retinol dehydrogenase 14 OS=Mus musculus GN=Rdh14 PE=1 SV=1 9 319 7.0E-19
sp|Q5SS80|DHR13_MOUSE Dehydrogenase/reductase SDR family member 13 OS=Mus musculus GN=Dhrs13 PE=1 SV=1 23 274 2.0E-18
sp|Q6UX07|DHR13_HUMAN Dehydrogenase/reductase SDR family member 13 OS=Homo sapiens GN=DHRS13 PE=2 SV=1 25 239 3.0E-18
sp|Q9VLU5|WWOX_DROME WW domain-containing oxidoreductase OS=Drosophila melanogaster GN=Wwox PE=2 SV=1 25 236 5.0E-18
sp|Q9HBH5|RDH14_HUMAN Retinol dehydrogenase 14 OS=Homo sapiens GN=RDH14 PE=1 SV=1 26 319 1.0E-17
sp|Q17QU7|DHR13_BOVIN Dehydrogenase/reductase SDR family member 13 OS=Bos taurus GN=DHRS13 PE=2 SV=1 21 239 4.0E-17
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 25 274 6.0E-17
sp|Q5R9W5|WWOX_PONAB WW domain-containing oxidoreductase OS=Pongo abelii GN=WWOX PE=2 SV=1 9 234 8.0E-17
sp|Q9NZC7|WWOX_HUMAN WW domain-containing oxidoreductase OS=Homo sapiens GN=WWOX PE=1 SV=1 9 234 2.0E-16
sp|Q91WL8|WWOX_MOUSE WW domain-containing oxidoreductase OS=Mus musculus GN=Wwox PE=1 SV=1 9 234 2.0E-16
sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 1 243 1.0E-15
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 26 243 2.0E-15
sp|Q5F389|WWOX_CHICK WW domain-containing oxidoreductase OS=Gallus gallus GN=WWOX PE=2 SV=2 9 234 2.0E-14
sp|Q08651|ENV9_YEAST Probable oxidoreductase ENV9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV9 PE=1 SV=1 24 154 2.0E-13
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 25 240 8.0E-13
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 30 159 5.0E-12
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 26 159 9.0E-12
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 30 159 3.0E-11
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 25 240 4.0E-11
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 24 174 9.0E-11
sp|Q92247|BLI4_NEUCR Putative oxidoreductase bli-4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bli-4 PE=1 SV=1 14 212 3.0E-10
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 30 155 6.0E-10
sp|Q803A8|WWOX_DANRE WW domain-containing oxidoreductase OS=Danio rerio GN=wwox PE=2 SV=1 25 234 7.0E-10
sp|O88736|DHB7_MOUSE 3-keto-steroid reductase OS=Mus musculus GN=Hsd17b7 PE=1 SV=1 29 232 8.0E-10
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 30 155 8.0E-10
sp|Q62904|DHB7_RAT 3-keto-steroid reductase OS=Rattus norvegicus GN=Hsd17b7 PE=1 SV=1 29 232 1.0E-09
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 30 155 2.0E-09
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 26 174 2.0E-09
sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 18 271 2.0E-09
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 20 238 3.0E-09
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 29 232 4.0E-09
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 30 155 1.0E-08
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 29 156 1.0E-08
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 25 155 1.0E-08
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 26 148 3.0E-08
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 26 175 4.0E-08
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 29 156 1.0E-07
sp|Q8VBZ0|DHRSX_MOUSE Dehydrogenase/reductase SDR family member on chromosome X homolog OS=Mus musculus GN=Dhrsx PE=1 SV=2 23 142 1.0E-07
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 29 156 2.0E-07
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 28 178 4.0E-07
sp|Q53877|DNRU_STRS5 Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces sp. (strain C5) PE=3 SV=1 26 251 4.0E-07
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 32 161 5.0E-07
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 26 148 7.0E-07
sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=2 SV=2 16 218 8.0E-07
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 20 232 1.0E-06
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 32 161 1.0E-06
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 32 161 1.0E-06
sp|Q59RQ2|TSC10_CANAL 3-ketodihydrosphingosine reductase TSC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSC10 PE=3 SV=1 18 122 1.0E-06
sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 32 161 2.0E-06
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 32 161 2.0E-06
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 26 178 2.0E-06
sp|Q9M2E2|SDR1_ARATH (+)-neomenthol dehydrogenase OS=Arabidopsis thaliana GN=SDR1 PE=1 SV=1 27 120 2.0E-06
sp|Q9ZUH5|SDR2B_ARATH Short-chain dehydrogenase/reductase 2b OS=Arabidopsis thaliana GN=SDR2b PE=2 SV=1 32 120 3.0E-06
sp|Q9ZAU1|DNRU_STRPE Putative daunorubicin C-13 ketoreductase DnrU OS=Streptomyces peucetius GN=dnrU PE=3 SV=1 26 251 4.0E-06
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 2 119 4.0E-06
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 25 144 5.0E-06
sp|Q01289|POR_PEA Protochlorophyllide reductase, chloroplastic OS=Pisum sativum GN=3PCR PE=1 SV=1 31 144 6.0E-06
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 25 144 6.0E-06
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 29 156 7.0E-06
sp|Q42850|PORB_HORVU Protochlorophyllide reductase B, chloroplastic OS=Hordeum vulgare GN=PORB PE=2 SV=1 32 322 7.0E-06
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 29 156 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1389
MPGMISFMRQSYPGKPTFTEQDIPDLTAKVVVVTGSNTGLGKELAQILYAKNAKVYMMARSESKTRSAMDSIRAA
HPTSQGELVYIALDLSDLHKVKQAAQEFLARESHLHYLFNNAGVGYPAAGSKSKQGYELQLGVNCIGTFALTKLL
DPALVAAARALPQRASVRVIWMSSSAAEGISPDNFVENLSTIEKRSSMDQYFISKLGTYLYATEYAQRHQQDGIV
SIPINPGNLDSELWRTQGAVVSCILRKTLLHPPIYGAYTASFAAFSTKVTMEKTGSFVAPWGKFWDLPKNVLDLT
KTPSQGGNGTARKFWDWTDEQIKPYM*
Coding >OphauB2|1389
ATGCCTGGCATGATTAGCTTCATGAGGCAGTCCTACCCGGGCAAGCCTACATTTACCGAGCAAGATATCCCTGAT
CTTACCGCAAAGGTCGTCGTTGTCACCGGCTCCAACACTGGCCTCGGCAAGGAACTCGCCCAGATTCTCTACGCC
AAGAATGCAAAGGTCTACATGATGGCTCGTTCTGAGAGCAAGACGCGGTCCGCCATGGACAGCATCCGCGCCGCT
CATCCCACCTCTCAAGGCGAACTCGTCTACATTGCCCTCGACCTCAGCGATCTGCACAAGGTCAAGCAAGCAGCC
CAAGAGTTCCTGGCCCGTGAAAGCCATCTGCACTACCTCTTCAACAACGCTGGCGTTGGCTATCCCGCTGCTGGC
AGCAAGTCCAAACAGGGCTACGAGCTGCAGCTCGGTGTCAACTGCATCGGCACCTTTGCTCTGACAAAGCTCCTG
GACCCCGCCCTGGTGGCTGCTGCTCGTGCCCTGCCCCAGCGCGCCTCGGTCCGCGTCATCTGGATGTCATCATCG
GCCGCAGAAGGCATCAGCCCGGACAATTTTGTCGAGAACCTGTCCACCATTGAGAAACGATCATCCATGGACCAG
TACTTCATCAGCAAGCTCGGCACCTACCTCTACGCCACCGAATATGCCCAGCGCCACCAACAAGACGGCATCGTC
AGCATCCCCATCAACCCGGGCAATCTCGACTCGGAACTCTGGCGCACCCAGGGCGCTGTCGTGAGCTGTATCCTC
CGCAAAACCCTCCTGCATCCCCCCATTTACGGTGCCTATACTGCCTCCTTTGCCGCCTTTTCCACCAAAGTCACC
ATGGAAAAGACTGGCAGCTTCGTTGCTCCATGGGGCAAGTTCTGGGACCTACCAAAGAATGTGCTCGATCTTACC
AAGACGCCTTCTCAGGGTGGCAATGGCACCGCCCGCAAGTTTTGGGACTGGACCGACGAGCAGATCAAGCCCTAC
ATGTAA
Transcript >OphauB2|1389
ATGCCTGGCATGATTAGCTTCATGAGGCAGTCCTACCCGGGCAAGCCTACATTTACCGAGCAAGATATCCCTGAT
CTTACCGCAAAGGTCGTCGTTGTCACCGGCTCCAACACTGGCCTCGGCAAGGAACTCGCCCAGATTCTCTACGCC
AAGAATGCAAAGGTCTACATGATGGCTCGTTCTGAGAGCAAGACGCGGTCCGCCATGGACAGCATCCGCGCCGCT
CATCCCACCTCTCAAGGCGAACTCGTCTACATTGCCCTCGACCTCAGCGATCTGCACAAGGTCAAGCAAGCAGCC
CAAGAGTTCCTGGCCCGTGAAAGCCATCTGCACTACCTCTTCAACAACGCTGGCGTTGGCTATCCCGCTGCTGGC
AGCAAGTCCAAACAGGGCTACGAGCTGCAGCTCGGTGTCAACTGCATCGGCACCTTTGCTCTGACAAAGCTCCTG
GACCCCGCCCTGGTGGCTGCTGCTCGTGCCCTGCCCCAGCGCGCCTCGGTCCGCGTCATCTGGATGTCATCATCG
GCCGCAGAAGGCATCAGCCCGGACAATTTTGTCGAGAACCTGTCCACCATTGAGAAACGATCATCCATGGACCAG
TACTTCATCAGCAAGCTCGGCACCTACCTCTACGCCACCGAATATGCCCAGCGCCACCAACAAGACGGCATCGTC
AGCATCCCCATCAACCCGGGCAATCTCGACTCGGAACTCTGGCGCACCCAGGGCGCTGTCGTGAGCTGTATCCTC
CGCAAAACCCTCCTGCATCCCCCCATTTACGGTGCCTATACTGCCTCCTTTGCCGCCTTTTCCACCAAAGTCACC
ATGGAAAAGACTGGCAGCTTCGTTGCTCCATGGGGCAAGTTCTGGGACCTACCAAAGAATGTGCTCGATCTTACC
AAGACGCCTTCTCAGGGTGGCAATGGCACCGCCCGCAAGTTTTGGGACTGGACCGACGAGCAGATCAAGCCCTAC
ATGTAA
Gene >OphauB2|1389
ATGCCTGGCATGATTAGCTTCATGAGGCAGTCCTACCCGGGCAAGCCTACATTTACCGAGCAAGATATCCCTGAT
CTTACCGCAAAGGTAGCTTTTCTCTCCTCCATCTTTGCTAGCACACCAAGACCAACAAGGCATGCAGGTCGTCGT
TGTCACCGGCTCCAACACTGGCCTCGGCAAGGAACTCGCCCAGATTCTCTACGCCAAGAATGCAAAGGTCTACAT
GATGGCTCGTTCTGAGAGCAAGACGCGGTCCGCCATGGACAGCATCCGCGCCGCTCATCCCACCTCTCAAGGCGA
ACTCGTCTACATTGCCCTCGACCTCAGCGATCTGCACAAGGTCAAGCAAGCAGCCCAAGAGTTCCTGGCCCGTGA
AAGCCATCTGCACTACCTCTTCAACAACGCTGGCGTTGGCTATCCCGCTGCTGGCAGCAAGTCCAAACAGGGCTA
CGAGCTGCAGCTCGGTGTCAACTGCATCGGCACCTTTGCTCTGACAAAGCTCCTGGACCCCGCCCTGGTGGCTGC
TGCTCGTGCCCTGCCCCAGCGCGCCTCGGTCCGCGTCATCTGGATGTCATCATCGGCCGCAGAAGGCATCAGCCC
GGACAATTTTGTCGAGAACCTGTCCACCATTGAGAAACGATCATCCATGGACCAGTACTTCATCAGCAAGCTCGG
CACCTACCTCTACGCCACCGAATATGCCCAGCGCCACCAACAAGACGGCATCGTCAGCATCCCCATCAACCCGGG
CAATCTCGACTCGGAACTCTGGCGCACCCAGGGCGCTGTCGTGAGCTGTATCCTCCGCAAAACCCTCCTGCATCC
CCCCATTTACGGTGCCTATACTGCCTCCTTTGCCGCCTTTTCCACCAAAGTCACCATGGAAAAGACTGGCAGCTT
CGTTGCTCCATGGGGCAAGTTCTGGGACCTACCAAAGAATGTGCTCGATCTTACCAAGACGCCTTCTCAGGGTGG
CAATGGCACCGCCCGCAAGTTTTGGGACTGGACCGACGAGCAGATCAAGCCCTACATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail