Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1388
Gene name
LocationContig_136:28047..29163
Strand+
Gene length (bp)1116
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 5.1E-06 24 95
PF00153 Mito_carr Mitochondrial carrier protein 2.5E-06 120 205
PF00153 Mito_carr Mitochondrial carrier protein 4.0E-14 214 304

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04013|YHM2_YEAST Citrate/oxoglutarate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHM2 PE=1 SV=1 11 316 6.0E-160
sp|P78763|YG1D_SCHPO Uncharacterized mitochondrial carrier C83.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.13 PE=2 SV=2 15 304 5.0E-97
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 42 283 5.0E-17
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 40 283 6.0E-12
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 43 284 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04013|YHM2_YEAST Citrate/oxoglutarate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHM2 PE=1 SV=1 11 316 6.0E-160
sp|P78763|YG1D_SCHPO Uncharacterized mitochondrial carrier C83.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.13 PE=2 SV=2 15 304 5.0E-97
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 42 283 5.0E-17
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 40 283 6.0E-12
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 43 284 2.0E-10
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 25 283 2.0E-10
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 40 283 3.0E-10
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 40 283 5.0E-10
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 58 304 5.0E-09
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 43 301 7.0E-09
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 58 304 7.0E-09
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 40 283 1.0E-08
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 43 301 2.0E-08
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 29 296 3.0E-08
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 43 280 3.0E-08
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 116 284 4.0E-08
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 19 283 5.0E-08
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 22 283 5.0E-08
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 43 280 6.0E-08
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 38 282 7.0E-08
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 39 245 1.0E-07
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 43 280 1.0E-07
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 55 301 2.0E-07
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 8 283 2.0E-07
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 38 281 2.0E-07
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 38 282 2.0E-07
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 14 285 3.0E-07
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 40 279 3.0E-07
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 19 283 1.0E-06
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 118 283 1.0E-06
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 27 188 1.0E-06
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 40 280 2.0E-06
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 43 281 2.0E-06
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 39 278 2.0E-06
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 123 304 2.0E-06
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 38 282 3.0E-06
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 40 296 4.0E-06
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 108 290 6.0E-06
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 123 304 7.0E-06
sp|Q54BF6|MCFN_DICDI Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 20 282 9.0E-06
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 19 283 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1388
MVATATLPGPAGGQKLEKKPIKFSNLLLGAGLNMFEVTTLGQPLEVIKTTMAAHRGDGFTTALGRIWSRGGVLGF
YQGLIPWAWIEASTKGAVLLFVASEAEYYARSAGASEFMGGIMGGITGGVAQAYATMGFCTCMKTVEITKHKMAA
SGIKPPSTFQTFMDIYRKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLAETWIRKSTGKSDTEKLSAWEKIVASG
LGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKMTVGNTFKYIYNNNGIRGLYRGVTPRIGLGIWQTICMVAFGDMA
KTYVEQLTGESVTGKH*
Coding >OphauB2|1388
ATGGTCGCGACGGCTACTCTTCCCGGCCCTGCTGGCGGGCAGAAGCTGGAGAAGAAGCCCATCAAGTTTTCAAAC
TTGCTCCTGGGTGCCGGGCTCAACATGTTCGAGGTGACGACTCTTGGTCAACCTCTCGAGGTCATCAAGACCACC
ATGGCCGCTCACCGTGGTGATGGCTTCACGACGGCTTTGGGACGTATTTGGTCTCGAGGCGGTGTTCTTGGGTTT
TACCAGGGCCTAATCCCTTGGGCTTGGATTGAGGCCTCGACCAAAGGCGCCGTTCTCCTCTTCGTCGCTTCCGAG
GCCGAGTACTATGCTCGTTCGGCGGGTGCCTCTGAGTTCATGGGCGGCATCATGGGCGGCATCACGGGCGGCGTG
GCCCAGGCCTATGCTACCATGGGCTTCTGTACCTGTATGAAGACGGTAGAGATCACCAAGCACAAGATGGCGGCG
TCGGGCATCAAGCCCCCTTCGACCTTTCAGACATTTATGGATATTTATCGCAAGGAAGGCATTCGTGGCATCAAC
AAGGGTGTCAATGCTGTCGCCATCAGACAAATGACCAACTGGGGCAGCCGCTTCGGTCTCAGCCGCCTTGCGGAA
ACTTGGATTCGCAAATCCACTGGTAAAAGTGACACCGAGAAGCTCTCGGCCTGGGAGAAAATTGTGGCCAGTGGT
CTAGGTGGTGGTCTAAGCGCCTGGAACCAGCCCATTGAAGTGATTCGCGTCGAGATGCAGAGCAAAAAGGAAGAT
CCAAACCGGCCCAAGAAGATGACGGTTGGCAACACCTTCAAGTACATCTATAACAACAATGGCATCAGAGGCTTG
TACCGCGGCGTCACACCCCGCATCGGCCTGGGCATCTGGCAGACTATTTGCATGGTTGCCTTTGGAGACATGGCA
AAGACCTACGTCGAGCAGTTGACGGGTGAGTCTGTTACGGGTAAGCACTAG
Transcript >OphauB2|1388
ATGGTCGCGACGGCTACTCTTCCCGGCCCTGCTGGCGGGCAGAAGCTGGAGAAGAAGCCCATCAAGTTTTCAAAC
TTGCTCCTGGGTGCCGGGCTCAACATGTTCGAGGTGACGACTCTTGGTCAACCTCTCGAGGTCATCAAGACCACC
ATGGCCGCTCACCGTGGTGATGGCTTCACGACGGCTTTGGGACGTATTTGGTCTCGAGGCGGTGTTCTTGGGTTT
TACCAGGGCCTAATCCCTTGGGCTTGGATTGAGGCCTCGACCAAAGGCGCCGTTCTCCTCTTCGTCGCTTCCGAG
GCCGAGTACTATGCTCGTTCGGCGGGTGCCTCTGAGTTCATGGGCGGCATCATGGGCGGCATCACGGGCGGCGTG
GCCCAGGCCTATGCTACCATGGGCTTCTGTACCTGTATGAAGACGGTAGAGATCACCAAGCACAAGATGGCGGCG
TCGGGCATCAAGCCCCCTTCGACCTTTCAGACATTTATGGATATTTATCGCAAGGAAGGCATTCGTGGCATCAAC
AAGGGTGTCAATGCTGTCGCCATCAGACAAATGACCAACTGGGGCAGCCGCTTCGGTCTCAGCCGCCTTGCGGAA
ACTTGGATTCGCAAATCCACTGGTAAAAGTGACACCGAGAAGCTCTCGGCCTGGGAGAAAATTGTGGCCAGTGGT
CTAGGTGGTGGTCTAAGCGCCTGGAACCAGCCCATTGAAGTGATTCGCGTCGAGATGCAGAGCAAAAAGGAAGAT
CCAAACCGGCCCAAGAAGATGACGGTTGGCAACACCTTCAAGTACATCTATAACAACAATGGCATCAGAGGCTTG
TACCGCGGCGTCACACCCCGCATCGGCCTGGGCATCTGGCAGACTATTTGCATGGTTGCCTTTGGAGACATGGCA
AAGACCTACGTCGAGCAGTTGACGGGTGAGTCTGTTACGGGTAAGCACTAG
Gene >OphauB2|1388
ATGGTCGCGACGGCTACTCTTCCCGGCCCTGCTGGCGGGCAGAAGCTGGAGAAGAAGCCCATCAAGTTTTCAAAC
TTGCTCCTGGGTGCCGGGCTCAACATGTTCGAGGTGACGACTCTTGGTCAACCTCTCGAGGTCATCAAGACCACC
ATGGCCGCTCACCGTGGTGATGGCTTCACGACGGCTTTGGGACGTATTTGGTCTCGAGGCGGTGTTCTTGGGTGT
TTGTTTTACCCCCCCCCCTCCTCTCCCCTTCTTCCGCTTATGCCTGGTTGCTCGGGCTGCGCAGGTTTTACTGAC
ATAGCCCGTGTCTATAGTTTACCAGGGCCTAATCCCTTGGGCTTGGATTGAGGCCTCGACCAAAGGCGCCGTTCT
CCTCTTCGTCGCTTCCGAGGCCGAGTACTATGCTCGTTCGGCGGGTGCCTCTGAGTTCATGGGCGGCATCATGGG
CGGCATCACGGGCGGCGTGGCCCAGGCCTATGCTACCATGGGCTTCTGTACCTGTATGAAGACGGTAGAGATCAC
CAAGCACAAGATGGCGGCGTCGGGCATCAAGCCCCCTTCGACCTTTCAGACATTTATGGATATTTATCGCAAGGA
AGGCATTCGTGGCATCAACAAGGGTGTCAATGCTGTCGCCATCAGACAAATGACCAACTGGGGCAGCCGCTTCGG
TCTCAGCCGCCTTGCGGAAACTTGGATTCGCAAATCCACTGGTAAAAGTGACACCGAGAAGCTCTCGGCCTGGGA
GAAAATTGTGGCCAGTGGTCTAGGTGGTGGTCTAAGCGCCTGGAACCAGCCCATTGAAGTGATTCGCGTCGAGAT
GCAGAGCAAAAAGGAAGATCCAAACCGGCCCAAGAAGATGACGGTTGGCAACACCTTCAAGTACATCTATAACAA
CAATGGCATCAGAGGCTTGTACCGCGGCGTCACACCCCGCATCGGCCTGGGCATCTGGCAGACTATTTGCATGGT
TGCCTTTGGAGACATGTGAGTTTTTGCTCGGCTCAATTTTCTTTTCTCGTCTACACCAGCGTTACGAGTACTGAT
GCACTTTGTAGGGCAAAGACCTACGTCGAGCAGTTGACGGGTGAGTCTGTTACGGGTAAGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail