Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1386
Gene name
LocationContig_136:20585..23095
Strand-
Gene length (bp)2510
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 5.3E-10 26 146
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.4E-06 467 516

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE3|SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seb1 PE=1 SV=3 7 669 2.0E-85
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 448 614 1.0E-49
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 1 166 2.0E-16

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1386
MASSNTVAELEAGLQGMLELKPPGVSKKGVDNLTKLCIANIQSESVLIQKVYTHFKKAPGTHKLGVLYVVDLVTR
KWLERAKAQGQPVNSSAQDGTYAAGVNRVTELMPVLMNDVIQSAPDEQKDKIKKLLDIWEKAQTFPAPMLQASRE
KLSSVETSNPTPPNASTTPPGSPPTGLPATSNNNAAGSAVLAAPNGASILEALANIARQTAAATPAGPAAAAAPA
PSAVPSYNAPAQLPSLMPQQQPQAMPVPSFPPAATPSSLPYSVSQQILAQGGVQLPAIPGPNGQPPNAYAAAPAQ
GLDSTTHQQIMLIKALAEQGVPFDKIPALVQSMTGAGQGASQPSFQPPIPAAQGTFPTGQQPWAGPVSGVDGPRD
RGYLEHGQSPARFHGRSRSRSPDRGWGVRGSPRGGDDHDRNGRRGHDYRQRSPQGRRGRSDSPLEFPPIERWIDY
DPSLPAGHIRVLSRTLFVGGVTCTEADLRRIFSRYGIVQTCIVNKEKRHAFVKMLTRKDAVNAKDSTEDSRNLEL
PLRTRWGVGFGPRDCSDYSSGISVIPIHKLTEADRKWLLTAPYGGSGGRPIETGMCVEEPDIEIGAGVSSKAISR
RMQTDKGGSNGPKSTRNREDDNGRGRRGRDFGGNQQRRNDQGDQGSATGYPFDLSGMSNGMPNFASGFAYPNSGN
GN*
Coding >OphauB2|1386
ATGGCGTCTTCCAACACAGTAGCAGAATTGGAGGCCGGTCTTCAGGGCATGCTTGAGCTCAAGCCTCCTGGCGTG
TCCAAAAAGGGGGTAGACAACTTGACCAAGCTCTGTATCGCCAATATCCAGTCCGAGTCGGTTTTGATACAAAAA
GTCTACACGCATTTCAAAAAGGCACCCGGGACACACAAGTTGGGCGTTCTCTACGTAGTAGACCTTGTAACCCGC
AAGTGGCTTGAACGAGCAAAGGCCCAAGGACAGCCAGTAAACAGCTCTGCGCAGGACGGCACGTATGCCGCCGGA
GTCAACCGAGTGACGGAACTCATGCCCGTACTGATGAATGACGTTATTCAGTCTGCCCCCGACGAACAAAAGGAC
AAGATCAAGAAGCTTCTCGACATTTGGGAAAAGGCGCAAACCTTTCCCGCTCCAATGCTGCAAGCATCGAGGGAA
AAGCTGAGCAGCGTCGAAACCTCCAATCCGACCCCGCCAAATGCCTCGACAACACCTCCAGGCAGTCCACCGACG
GGTCTGCCAGCCACGTCCAACAACAATGCCGCCGGCTCGGCTGTTCTGGCCGCTCCCAACGGTGCTTCAATTCTC
GAGGCTCTTGCCAATATTGCTCGCCAAACGGCAGCAGCTACGCCCGCCGGTCCCGCTGCCGCTGCCGCACCCGCG
CCCTCCGCCGTGCCCTCATACAACGCGCCGGCTCAGCTGCCGTCTCTGATGCCGCAACAGCAGCCCCAGGCCATG
CCGGTGCCCTCCTTTCCTCCAGCCGCCACCCCATCCTCTTTACCATACTCGGTGTCACAACAAATCCTAGCCCAG
GGTGGTGTGCAGCTTCCTGCAATTCCTGGACCCAATGGCCAGCCGCCCAATGCCTACGCCGCGGCGCCGGCTCAG
GGACTTGACTCGACGACTCATCAGCAAATAATGCTCATCAAAGCTCTTGCAGAGCAGGGCGTCCCATTTGATAAA
ATTCCCGCGCTGGTACAGAGCATGACTGGTGCTGGCCAAGGCGCCAGCCAGCCCTCTTTCCAGCCTCCTATCCCC
GCGGCCCAAGGCACTTTCCCCACTGGACAACAGCCTTGGGCTGGCCCGGTCTCGGGAGTCGATGGCCCAAGGGAT
CGAGGCTATCTCGAGCATGGCCAGTCTCCCGCCCGTTTCCACGGGCGCTCTCGTTCCCGCTCCCCCGATCGCGGC
TGGGGTGTTCGAGGTTCCCCTCGCGGCGGAGATGATCACGACCGCAACGGCCGCCGTGGTCACGACTATCGCCAA
CGAAGTCCACAAGGAAGACGGGGACGCAGTGACTCGCCGCTCGAGTTTCCTCCCATTGAGAGATGGATCGACTAC
GATCCCTCCTTACCTGCAGGCCATATAAGAGTCCTCAGTCGTACCCTATTTGTAGGAGGAGTGACATGTACCGAA
GCCGATCTGCGTCGCATATTCAGTCGCTACGGCATAGTGCAGACTTGCATAGTAAATAAGGAAAAACGGCACGCC
TTTGTCAAAATGCTCACGCGCAAAGATGCCGTCAATGCCAAAGACAGTACTGAGGATAGCAGAAATCTCGAGCTT
CCTCTTAGGACACGTTGGGGTGTTGGTTTTGGTCCTAGAGATTGTAGCGACTATTCTTCTGGCATTAGTGTGATT
CCAATTCACAAACTTACCGAAGCTGATAGAAAATGGCTTTTAACGGCGCCTTATGGCGGCAGTGGAGGACGACCA
ATAGAAACGGGCATGTGTGTCGAAGAGCCCGACATTGAGATTGGAGCTGGTGTGTCTTCCAAGGCGATCAGCCGG
CGTATGCAAACAGACAAAGGCGGTAGCAACGGACCCAAGTCTACGCGTAACCGGGAGGATGACAACGGACGAGGA
CGCCGCGGACGTGACTTTGGAGGCAATCAGCAACGTCGGAATGACCAAGGGGATCAAGGCTCTGCCACTGGATAT
CCTTTTGACCTGAGCGGCATGTCGAATGGCATGCCCAACTTTGCCTCGGGCTTTGCATATCCAAACTCTGGAAAC
GGCAACTAA
Transcript >OphauB2|1386
ATGGCGTCTTCCAACACAGTAGCAGAATTGGAGGCCGGTCTTCAGGGCATGCTTGAGCTCAAGCCTCCTGGCGTG
TCCAAAAAGGGGGTAGACAACTTGACCAAGCTCTGTATCGCCAATATCCAGTCCGAGTCGGTTTTGATACAAAAA
GTCTACACGCATTTCAAAAAGGCACCCGGGACACACAAGTTGGGCGTTCTCTACGTAGTAGACCTTGTAACCCGC
AAGTGGCTTGAACGAGCAAAGGCCCAAGGACAGCCAGTAAACAGCTCTGCGCAGGACGGCACGTATGCCGCCGGA
GTCAACCGAGTGACGGAACTCATGCCCGTACTGATGAATGACGTTATTCAGTCTGCCCCCGACGAACAAAAGGAC
AAGATCAAGAAGCTTCTCGACATTTGGGAAAAGGCGCAAACCTTTCCCGCTCCAATGCTGCAAGCATCGAGGGAA
AAGCTGAGCAGCGTCGAAACCTCCAATCCGACCCCGCCAAATGCCTCGACAACACCTCCAGGCAGTCCACCGACG
GGTCTGCCAGCCACGTCCAACAACAATGCCGCCGGCTCGGCTGTTCTGGCCGCTCCCAACGGTGCTTCAATTCTC
GAGGCTCTTGCCAATATTGCTCGCCAAACGGCAGCAGCTACGCCCGCCGGTCCCGCTGCCGCTGCCGCACCCGCG
CCCTCCGCCGTGCCCTCATACAACGCGCCGGCTCAGCTGCCGTCTCTGATGCCGCAACAGCAGCCCCAGGCCATG
CCGGTGCCCTCCTTTCCTCCAGCCGCCACCCCATCCTCTTTACCATACTCGGTGTCACAACAAATCCTAGCCCAG
GGTGGTGTGCAGCTTCCTGCAATTCCTGGACCCAATGGCCAGCCGCCCAATGCCTACGCCGCGGCGCCGGCTCAG
GGACTTGACTCGACGACTCATCAGCAAATAATGCTCATCAAAGCTCTTGCAGAGCAGGGCGTCCCATTTGATAAA
ATTCCCGCGCTGGTACAGAGCATGACTGGTGCTGGCCAAGGCGCCAGCCAGCCCTCTTTCCAGCCTCCTATCCCC
GCGGCCCAAGGCACTTTCCCCACTGGACAACAGCCTTGGGCTGGCCCGGTCTCGGGAGTCGATGGCCCAAGGGAT
CGAGGCTATCTCGAGCATGGCCAGTCTCCCGCCCGTTTCCACGGGCGCTCTCGTTCCCGCTCCCCCGATCGCGGC
TGGGGTGTTCGAGGTTCCCCTCGCGGCGGAGATGATCACGACCGCAACGGCCGCCGTGGTCACGACTATCGCCAA
CGAAGTCCACAAGGAAGACGGGGACGCAGTGACTCGCCGCTCGAGTTTCCTCCCATTGAGAGATGGATCGACTAC
GATCCCTCCTTACCTGCAGGCCATATAAGAGTCCTCAGTCGTACCCTATTTGTAGGAGGAGTGACATGTACCGAA
GCCGATCTGCGTCGCATATTCAGTCGCTACGGCATAGTGCAGACTTGCATAGTAAATAAGGAAAAACGGCACGCC
TTTGTCAAAATGCTCACGCGCAAAGATGCCGTCAATGCCAAAGACAGTACTGAGGATAGCAGAAATCTCGAGCTT
CCTCTTAGGACACGTTGGGGTGTTGGTTTTGGTCCTAGAGATTGTAGCGACTATTCTTCTGGCATTAGTGTGATT
CCAATTCACAAACTTACCGAAGCTGATAGAAAATGGCTTTTAACGGCGCCTTATGGCGGCAGTGGAGGACGACCA
ATAGAAACGGGCATGTGTGTCGAAGAGCCCGACATTGAGATTGGAGCTGGTGTGTCTTCCAAGGCGATCAGCCGG
CGTATGCAAACAGACAAAGGCGGTAGCAACGGACCCAAGTCTACGCGTAACCGGGAGGATGACAACGGACGAGGA
CGCCGCGGACGTGACTTTGGAGGCAATCAGCAACGTCGGAATGACCAAGGGGATCAAGGCTCTGCCACTGGATAT
CCTTTTGACCTGAGCGGCATGTCGAATGGCATGCCCAACTTTGCCTCGGGCTTTGCATATCCAAACTCTGGAAAC
GGCAACTAA
Gene >OphauB2|1386
ATGGCGTCTTCCAACACAGTAGCAGAATTGGAGGCCGGTCTTCAGGGCATGCTTGAGCTCAAGCCTCCTGGCGTG
TCCAAAAAGGGGGTAGACAACTTGACCAAGCTCTGTATCGCCAATATCCAGGTATGGTGGTCTGGTCCGCCACGG
AAGCCAGGCGTCTGAGGGGCTCTTACTGATGTTTGTTACTTGCTAGTCCGAGTCGGTTTTGATACAAAAAGTCTA
CACGCATTTCAAAAAGGCACCCGGGACACACAAGTTGGGCGTTCTCTACGTAGTAGACCTTGTAACCCGCAAGTG
GCTTGAACGAGCAAAGGCCCAAGGACAGCCAGTAAACAGCTCTGCGCAGGACGGCACGTATGCCGCCGGAGTCAA
CCGAGTGACGGAACTCATGCCCGTACTGATGAATGACGTTATTCAGTCTGCCCCCGACGAACAAAAGGTACGCAC
AACCTCTTTTTCTGCATGCGTAGGTCGTCTTGGACAGAGGAATTGGGACGAAAAGCGCCCTCCGTCAGCGTCACA
ACCATGCCTGGTCTCGGCACTGCACGGCGCTGCGCTGCACTCTGCACATGCACATGCGCGTGGCCATATCTTCGT
TTCCCACAACTGGCCAATAGATACAGTACGAACAGTAGCTTACCAACATGTCTTTGCCTTGTAGGACAAGATCAA
GAAGCTTCTCGACATTTGGGAAAAGGCGCAAACCTTTCCCGCTCCAATGCTGCAAGCATCGAGGGAAAAGCTGAG
CAGCGTCGAAACCTCCAATCCGACCCCGCCAAGTATGTCTTGTCGGACCCGTAGTGCTCCAGTGCGCAGCCACTG
ACCGTATGTCTGTATCTAGATGCCTCGACAACACCTCCAGGCAGTCCACCGACGGGTCTGCCAGCCACGTCCAAC
AACAATGCCGCCGGCTCGGCTGTTCTGGCCGCTCCCAACGGTGCTTCAATTCTCGAGGCTCTTGCCAATATTGCT
CGCCAAACGGCAGCAGCTACGCCCGCCGGTCCCGCTGCCGCTGCCGCACCCGCGCCCTCCGCCGTGCCCTCATAC
AACGCGCCGGCTCAGCTGCCGTCTCTGATGCCGCAACAGCAGCCCCAGGCCATGCCGGTGCCCTCCTTTCCTCCA
GCCGCCACCCCATCCTCTTTACCATACTCGGTGTCACAACAAATCCTAGCCCAGGGTGGTGTGCAGCTTCCTGCA
ATTCCTGGACCCAATGGCCAGCCGCCCAATGCCTACGCCGCGGCGCCGGCTCAGGGACTTGACTCGACGACTCAT
CAGCAAATAATGCTCATCAAAGCTCTTGCAGAGCAGGGCGTCCCATTTGATAAAATTCCCGCGCTGGTACAGAGC
ATGACTGGTGCTGGCCAAGGCGCCAGCCAGCCCTCTTTCCAGCCTCCTATCCCCGCGGCCCAAGGCACTTTCCCC
ACTGGACAACAGCCTTGGGCTGGCCCGGTCTCGGGAGTCGATGGCCCAAGGGATCGAGGCTATCTCGAGCATGGC
CAGTCTCCCGCCCGTTTCCACGGGCGCTCTCGTTCCCGCTCCCCCGATCGCGGCTGGGGTGTTCGAGGTTCCCCT
CGCGGCGGAGATGATCACGACCGCAACGGCCGCCGTGGTCACGACTATCGCCAACGAAGTCCACAAGGAAGACGG
GGACGCAGTGACTCGCCGCTCGAGTTTCCTCCCATTGAGAGATGGATCGACTACGATCCCTCCTTACCTGCAGGC
CATATAAGAGTCCTCAGTCGTACCCTATTTGTAGGAGGAGTGACGTAAGTCGGCGCCTTGGCCAACACGGACGGG
CCATTCTCGTGTTGCTAACCAACTGTCAGATGTACCGAAGCCGATCTGCGTCGCATATTCAGTCGCTACGGCATA
GTGCAGACTTGCATAGTAAATAAGGAAAAACGGCACGCCTTTGTCAAAATGCTCACGCGCAAAGATGCCGTCAAT
GCCAAAGACAGTACTGAGGATAGCAGAAATCTCGAGCTTCCTCTTAGGGTAAGCAACTCGGCTACCAACACGGCA
TGTAAGGAGTAAGACAGCTAACAAGGTCATGGCAGACACGTTGGGGTGTTGGTTTTGGTCCTAGAGATTGTAGCG
ACTATTCTTCTGGCATTAGTGTGATTCCAATTCACAAACTTACCGAAGCTGATAGAAAATGGCTTTTAACGGCGC
CTTATGGCGGCAGTGGAGGACGACCAATAGAAACGGGCATGTGTGTCGAAGAGCCCGACATTGAGATTGGAGCTG
GTGTGTCTTCCAAGGCGATCAGCCGGCGTATGCAAACAGACAAAGGCGGTAGCAACGGACCCAAGTCTACGCGTA
ACCGGGAGGATGACAACGGACGAGGACGCCGCGGACGTGACTTTGGAGGCAATCAGCAACGTCGGAATGACCAAG
GGGATCAAGGCTCTGCCACTGGATATCCTTTTGACCTGAGCGGCATGTCGAATGGCATGCCCAACTTTGCCTCGG
GCTTTGCATATCCAAACTCTGGAAACGGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail