Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1378
Gene name
LocationContig_135:46835..48484
Strand-
Gene length (bp)1649
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06441 EHN Epoxide hydrolase N terminus 8.9E-25 7 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06816|HYEP_STIAD Putative epoxide hydrolase OS=Stigmatella aurantiaca (strain DW4/3-1) GN=STAUR_4299 PE=3 SV=2 7 327 1.0E-20
sp|P79381|HYEP_PIG Epoxide hydrolase 1 OS=Sus scrofa GN=EPHX1 PE=2 SV=1 4 419 1.0E-15
sp|Q8MZR6|HYEP1_CTEFE Juvenile hormone epoxide hydrolase 1 OS=Ctenocephalides felis GN=EH1 PE=1 SV=3 3 182 5.0E-15
sp|Q8MZR5|HYEP2_CTEFE Juvenile hormone epoxide hydrolase 2 OS=Ctenocephalides felis GN=EH2 PE=2 SV=1 3 215 1.0E-14
sp|Q9D379|HYEP_MOUSE Epoxide hydrolase 1 OS=Mus musculus GN=Ephx1 PE=1 SV=2 4 301 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06816|HYEP_STIAD Putative epoxide hydrolase OS=Stigmatella aurantiaca (strain DW4/3-1) GN=STAUR_4299 PE=3 SV=2 7 327 1.0E-20
sp|P79381|HYEP_PIG Epoxide hydrolase 1 OS=Sus scrofa GN=EPHX1 PE=2 SV=1 4 419 1.0E-15
sp|Q8MZR6|HYEP1_CTEFE Juvenile hormone epoxide hydrolase 1 OS=Ctenocephalides felis GN=EH1 PE=1 SV=3 3 182 5.0E-15
sp|Q8MZR5|HYEP2_CTEFE Juvenile hormone epoxide hydrolase 2 OS=Ctenocephalides felis GN=EH2 PE=2 SV=1 3 215 1.0E-14
sp|Q9D379|HYEP_MOUSE Epoxide hydrolase 1 OS=Mus musculus GN=Ephx1 PE=1 SV=2 4 301 3.0E-14
sp|P04068|HYEP_RABIT Epoxide hydrolase 1 OS=Oryctolagus cuniculus GN=EPHX1 PE=1 SV=2 4 301 4.0E-14
sp|P07687|HYEP_RAT Epoxide hydrolase 1 OS=Rattus norvegicus GN=Ephx1 PE=1 SV=1 4 301 1.0E-13
sp|P07099|HYEP_HUMAN Epoxide hydrolase 1 OS=Homo sapiens GN=EPHX1 PE=1 SV=1 4 329 2.0E-11
sp|Q25489|HYEP_MANSE Juvenile hormone epoxide hydrolase OS=Manduca sexta PE=1 SV=1 4 296 2.0E-11
sp|Q6U6J0|HYEP_BOMMO Juvenile hormone epoxide hydrolase OS=Bombyx mori GN=JHEH PE=1 SV=1 4 301 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1378
MVVDEDIKSYRVHVSSKYLDLTRRKLELTRLPHSAPEPRTDQWWEPRATVEPLLDFWLERFSWRNEEKELNSKVP
QFRTAIKTAACEAPIRLHFIHAQSPHARALPLLLIPPFPFSNLALAHLVMLFTHPIEMNSQPFHMVMPSLPGLGF
SDALPDRQDAIETIADMFDTLMRRLGYAKFLVTTAGASAYAPARVDWRIAHYLACYYSTSCIGAHLVSPPLKAPS
WTSPLEWIKWKTASLVRRPMFGYCRQDVDCWRKRRSRPSVKKTRFPAQLGCQGAHEPNTLAYALCDSPLGLLLFF
LMVIRGAGPTRDLPSNEVIKITELAWIPGPEGMMRLWANCQSCSEADNTSRGNKPKVAITVFQGSSETQQIGQPW
PVKDEYACPGWARSHYDVVSSSRISGRPGLLAWERPQVIVAGTRGLAKAILTGSQQTAAAALDQVVVGRHGQHQE
ATRISETTLLVIEADETASASQASAGVTARAMSRQDGFDDRGDEELGEGSPDTVIAVQLG*
Coding >OphauB2|1378
ATGGTTGTGGATGAGGATATCAAATCCTATCGAGTTCACGTCTCAAGCAAATATCTCGACCTAACGCGGCGCAAA
CTCGAACTTACACGACTGCCACACAGCGCACCTGAGCCCAGGACGGACCAATGGTGGGAGCCTCGGGCAACTGTT
GAACCACTTCTTGACTTTTGGCTTGAAAGATTCTCGTGGCGCAACGAGGAAAAGGAGCTCAATTCAAAGGTGCCC
CAGTTCCGGACCGCCATCAAGACGGCAGCATGCGAAGCACCCATAAGGCTGCACTTTATCCATGCGCAGTCGCCC
CACGCGAGGGCGCTTCCCTTGCTGCTCATTCCGCCATTTCCTTTCTCCAATCTGGCCTTGGCCCATCTCGTCATG
CTCTTCACCCACCCCATTGAGATGAACAGCCAGCCCTTTCACATGGTGATGCCGTCGCTGCCGGGACTCGGCTTC
AGCGACGCCTTGCCAGACCGCCAGGATGCAATAGAAACCATTGCTGACATGTTTGACACGCTGATGCGGCGGCTG
GGCTACGCAAAGTTTCTCGTCACCACTGCGGGGGCGTCGGCATATGCGCCGGCTCGTGTGGACTGGCGAATTGCC
CACTATCTGGCCTGTTACTATAGCACATCTTGTATAGGGGCTCACCTCGTGTCGCCACCTCTCAAAGCGCCAAGC
TGGACGTCGCCTCTTGAATGGATCAAATGGAAAACAGCCAGCCTCGTGCGGCGCCCAATGTTCGGCTACTGTCGG
CAAGACGTCGATTGCTGGAGGAAGCGCCGCAGCAGGCCGTCTGTCAAGAAGACAAGATTTCCTGCACAGCTGGGC
TGCCAGGGAGCGCACGAGCCAAACACGCTGGCCTACGCGCTATGCGACTCCCCCCTCGGCCTGCTGCTCTTTTTC
CTCATGGTTATACGCGGGGCAGGGCCAACAAGAGATTTGCCATCAAACGAGGTGATCAAAATCACAGAGCTAGCA
TGGATTCCTGGCCCAGAGGGCATGATGAGGCTGTGGGCAAACTGCCAATCCTGTAGCGAAGCCGACAATACGAGC
CGTGGCAACAAGCCAAAGGTTGCCATTACAGTCTTCCAGGGCAGCTCAGAGACACAGCAAATAGGACAGCCCTGG
CCCGTCAAGGATGAATATGCATGTCCCGGGTGGGCAAGAAGCCATTACGACGTTGTCTCGTCGAGCCGCATCTCG
GGAAGACCTGGGCTACTGGCGTGGGAGCGGCCTCAAGTAATCGTGGCAGGCACTAGGGGCCTTGCCAAGGCAATC
CTGACAGGTTCCCAACAAACGGCAGCAGCAGCACTGGACCAGGTTGTAGTGGGCCGACATGGCCAGCATCAAGAG
GCGACCAGAATCTCAGAGACGACCTTGTTGGTTATTGAAGCAGACGAGACGGCTTCGGCTTCTCAGGCCAGTGCT
GGAGTCACGGCGCGGGCCATGTCGCGGCAAGACGGCTTTGACGACAGAGGCGACGAGGAACTCGGTGAAGGGAGC
CCCGATACTGTGATAGCAGTGCAGCTAGGATGA
Transcript >OphauB2|1378
ATGGTTGTGGATGAGGATATCAAATCCTATCGAGTTCACGTCTCAAGCAAATATCTCGACCTAACGCGGCGCAAA
CTCGAACTTACACGACTGCCACACAGCGCACCTGAGCCCAGGACGGACCAATGGTGGGAGCCTCGGGCAACTGTT
GAACCACTTCTTGACTTTTGGCTTGAAAGATTCTCGTGGCGCAACGAGGAAAAGGAGCTCAATTCAAAGGTGCCC
CAGTTCCGGACCGCCATCAAGACGGCAGCATGCGAAGCACCCATAAGGCTGCACTTTATCCATGCGCAGTCGCCC
CACGCGAGGGCGCTTCCCTTGCTGCTCATTCCGCCATTTCCTTTCTCCAATCTGGCCTTGGCCCATCTCGTCATG
CTCTTCACCCACCCCATTGAGATGAACAGCCAGCCCTTTCACATGGTGATGCCGTCGCTGCCGGGACTCGGCTTC
AGCGACGCCTTGCCAGACCGCCAGGATGCAATAGAAACCATTGCTGACATGTTTGACACGCTGATGCGGCGGCTG
GGCTACGCAAAGTTTCTCGTCACCACTGCGGGGGCGTCGGCATATGCGCCGGCTCGTGTGGACTGGCGAATTGCC
CACTATCTGGCCTGTTACTATAGCACATCTTGTATAGGGGCTCACCTCGTGTCGCCACCTCTCAAAGCGCCAAGC
TGGACGTCGCCTCTTGAATGGATCAAATGGAAAACAGCCAGCCTCGTGCGGCGCCCAATGTTCGGCTACTGTCGG
CAAGACGTCGATTGCTGGAGGAAGCGCCGCAGCAGGCCGTCTGTCAAGAAGACAAGATTTCCTGCACAGCTGGGC
TGCCAGGGAGCGCACGAGCCAAACACGCTGGCCTACGCGCTATGCGACTCCCCCCTCGGCCTGCTGCTCTTTTTC
CTCATGGTTATACGCGGGGCAGGGCCAACAAGAGATTTGCCATCAAACGAGGTGATCAAAATCACAGAGCTAGCA
TGGATTCCTGGCCCAGAGGGCATGATGAGGCTGTGGGCAAACTGCCAATCCTGTAGCGAAGCCGACAATACGAGC
CGTGGCAACAAGCCAAAGGTTGCCATTACAGTCTTCCAGGGCAGCTCAGAGACACAGCAAATAGGACAGCCCTGG
CCCGTCAAGGATGAATATGCATGTCCCGGGTGGGCAAGAAGCCATTACGACGTTGTCTCGTCGAGCCGCATCTCG
GGAAGACCTGGGCTACTGGCGTGGGAGCGGCCTCAAGTAATCGTGGCAGGCACTAGGGGCCTTGCCAAGGCAATC
CTGACAGGTTCCCAACAAACGGCAGCAGCAGCACTGGACCAGGTTGTAGTGGGCCGACATGGCCAGCATCAAGAG
GCGACCAGAATCTCAGAGACGACCTTGTTGGTTATTGAAGCAGACGAGACGGCTTCGGCTTCTCAGGCCAGTGCT
GGAGTCACGGCGCGGGCCATGTCGCGGCAAGACGGCTTTGACGACAGAGGCGACGAGGAACTCGGTGAAGGGAGC
CCCGATACTGTGATAGCAGTGCAGCTAGGATGA
Gene >OphauB2|1378
ATGGTTGTGGATGAGGATATCAAATCCTATCGAGTTCACGTACGACGGTTCCAGATAGACGCTGTAGCTAGCACG
GTCAAGTTGACAAGGAGGCCAGGTCTCAAGCAAATATCTCGACCTAACGCGGCGCAAACTCGAACTTACACGACT
GCCACACAGCGCACCTGAGCCCAGGACGGACCAATGGTGGGAGCCTCGGGCAACTGTTGAACCACTTCTTGACTT
TTGGTAACGGGGATCCCATGATGCACTTGCGGGGTCCCGCCCATCTGACTTGAACCTGCAGGCTTGAAAGATTCT
CGTGGCGCAACGAGGAAAAGGAGCTCAATTCAAAGGTGCCCCAGTTCCGGACCGCCATCAAGACGGCAGCATGCG
AAGCACCCATAAGGCTGCACTTTATCCATGCGCAGTCGCCCCACGCGAGGGCGCTTCCCTTGCTGCTCATTCCGC
CATTTCCTTTCTCCAATCTGGCCTTGGCCCATCTCGTCATGCTCTTCACCCACCCCATTGAGATGAACAGCCAGC
CCTTTCACATGGTGATGCCGTCGCTGCCGGGACTCGGCTTCAGCGACGCCTTGCCAGACCGCCAGGATGCAATAG
AAACCATTGCTGACATGTTTGACACGCTGATGCGGCGGCTGGGCTACGCAAAGTTTCTCGTCACCACTGCGGGGG
CGTCGGCATATGCGCCGGCTCGTGTGGACTGGCGAATTGCCCACTATCTGGCCTGTTACTATAGCACATCTTGTA
TAGGGGCTCACCTCGTGTCGCCACCTCTCAAAGCGCCAAGCTGGACGTCGCCTCTTGAATGGATCAAATGGAAAA
CAGCCAGCCTCGTGCGGCGCCCAATGTTCGGCTACTGTCGGCAAGACGTCGATTGCTGGAGGAAGCGCCGCAGCA
GGCCGTCTGTCAAGAAGACAAGATTTCCTGCACAGCTGGGCTGCCAGGGAGCGCACGAGCCAAACACGCTGGCCT
ACGCGCTATGCGACTCCCCCCTCGGCCTGCTGCTCTTTTTCCTCATGGTTATACGCGGGGCAGGGCCAACAAGAG
ATTTGCCATCAAACGAGGTGATCAAAATCACAGAGCTAGCATGGATTCCTGGCCCAGAGGGCATGATGAGGCTGT
GGGCAAACTGCCAATCCTGTAGCGAAGCCGACAATACGAGCCGTGGCAACAAGCCAAAGGTTGCCATTACAGTCT
TCCAGGGCAGCTCAGAGACACAGCAAATAGGACAGCCCTGGCCCGTCAAGGATGAATATGCATGTCCCGGGTGGG
CAAGAAGCCATTACGACGTTGTCTCGTCGAGCCGCATCTCGGGAAGACCTGGGCTACTGGCGTGGGAGCGGCCTC
AAGTAATCGTGGCAGGCACTAGGGGCCTTGCCAAGGCAATCCTGACAGGTTCCCAACAAACGGCAGCAGCAGCAC
TGGACCAGGTTGTAGTGGGCCGACATGGCCAGCATCAAGAGGCGACCAGAATCTCAGAGACGACCTTGTTGGTTA
TTGAAGCAGACGAGACGGCTTCGGCTTCTCAGGCCAGTGCTGGAGTCACGGCGCGGGCCATGTCGCGGCAAGACG
GCTTTGACGACAGAGGCGACGAGGAACTCGGTGAAGGGAGCCCCGATACTGTGATAGCAGTGCAGCTAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail