Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1377
Gene name
LocationContig_135:43204..46491
Strand-
Gene length (bp)3287
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04048 Sec8_exocyst Sec8 exocyst complex component specific domain 4.3E-47 92 231
PF10475 Vps54_N Vacuolar-sorting protein 54, of GARP complex 3.3E-11 132 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE88|SEC8_NEUCR Probable exocyst complex component sec8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec8 PE=3 SV=1 49 1077 0.0E+00
sp|O74562|SEC8_SCHPO Exocyst complex component sec8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec8 PE=1 SV=2 30 1016 1.0E-45
sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens GN=EXOC4 PE=1 SV=1 128 1015 2.0E-45
sp|Q62824|EXOC4_RAT Exocyst complex component 4 OS=Rattus norvegicus GN=Exoc4 PE=1 SV=1 128 1015 2.0E-45
sp|O35382|EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus GN=Exoc4 PE=1 SV=2 128 1015 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE88|SEC8_NEUCR Probable exocyst complex component sec8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec8 PE=3 SV=1 49 1077 0.0E+00
sp|O74562|SEC8_SCHPO Exocyst complex component sec8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec8 PE=1 SV=2 30 1016 1.0E-45
sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens GN=EXOC4 PE=1 SV=1 128 1015 2.0E-45
sp|Q62824|EXOC4_RAT Exocyst complex component 4 OS=Rattus norvegicus GN=Exoc4 PE=1 SV=1 128 1015 2.0E-45
sp|O35382|EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus GN=Exoc4 PE=1 SV=2 128 1015 1.0E-44
sp|P32855|SEC8_YEAST Exocyst complex component SEC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC8 PE=1 SV=1 96 1048 2.0E-41
sp|Q9VNH6|EXOC4_DROME Exocyst complex component 4 OS=Drosophila melanogaster GN=Sec8 PE=1 SV=3 146 487 2.0E-17
sp|Q54P76|EXOC4_DICDI Exocyst complex component 4 OS=Dictyostelium discoideum GN=exoc4 PE=3 SV=1 148 293 4.0E-13
sp|Q93YU5|SEC8_ARATH Exocyst complex component SEC8 OS=Arabidopsis thaliana GN=SEC8 PE=1 SV=1 151 295 5.0E-12
sp|Q54P76|EXOC4_DICDI Exocyst complex component 4 OS=Dictyostelium discoideum GN=exoc4 PE=3 SV=1 665 991 6.0E-09
sp|Q9XWS2|EXOC4_CAEEL Exocyst complex component 4 OS=Caenorhabditis elegans GN=sec-8 PE=2 SV=2 589 1042 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006904 vesicle docking involved in exocytosis Yes
GO:0000145 exocyst Yes
GO:0032991 protein-containing complex No
GO:0099023 vesicle tethering complex No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0048278 vesicle docking No
GO:0005575 cellular_component No
GO:0140056 organelle localization by membrane tethering No
GO:0140029 exocytic process No
GO:0051640 organelle localization No
GO:0022406 membrane docking No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1377
MSNRYGTAMRNGNGYGNGNGNGYGNGYGNGYGNEYGNEYGNGKPPRSADDEYDPYGDAYPTDRYARRAGPPPVLR
NRPSRSRVRETSAERQITQVLEHIRSEWPSMCESDCVPVQLALQLLDSSSVGRAHDYRKFQQTHAYLQDSLKNIV
HEHHQGFNSSIGTFHKIQGSIQMSQKRVRALKESLGGAKSSLCTTDTGLKKLSETSQVYDELLQTLNELDELRAV
PDQLEARISEKRFLSAIDVLHNALRKLGRPELDDIGALSDLRTYLSNQEVALVDILVEELHEHLYLKSPYCQDRW
QSLSKSQGAFADGYGDGNSILPFHLVLESVDLDKSVTEDPMKNPEADTFYYISLLVEGLNKLGRLQSAVEILKQR
LPVELFGVVNETINEVDQRHPSSLRGGAGKTEQVRLYGSRETQLRADVIYDLLWTLYGKFEAIGEGHRVFHESIK
SLIRREGAGNNSALLGSFKELWNLYQNEIRSLLHNYVTTDADVYQFDSPATGGAMNGKKETMREHLFKFSEADSK
SVDMTTEYDALEGIIQATVPGLTSNSRKTDAKRNRAVIEGGISRRDRASGLGAARQTVGSYRSLVDPSVFNMSIL
LPPTLVFLQRLKSIVPPGSDLATGALTTFLDNFLVNVFQPQLDETLGKLSETVLGVSGSFSQDPAWRQWAPRPVF
KGVTAFFEVVTAFCRMLGTIPPDQALSSLIVTQMLRYYDRCFGWYRSLVTKTQDQATDSSNLRASARFSLQPGEV
QETMKRLWTSEELDKELLDKEVHLLIENTNENRLEMDDVIQDRDTISSLCLLYTSMKWLAAKVSGLRHITQHETD
SSRQSLPKRASRRWTLMNDPNKAVSDQGPVYLPLTQETVQTFDNIITSYEELAGTALLTLHMEVRCRIAYSLRMA
LSPDVAPYLLEHEVREPDPQILSLNLELVLFDETVVRFLREREIDFIRTGLGLLINCYLVSNAWMASPMNSKGCG
RMQLNILVLQQNLKNIEEGVDLGRAADYFGLYDQGPDAIIKRAQLDKEQEGGGESFTYEELKALVELCYSEQLAN
PERGIASAAKRKMDDKLLALSEHLWQT*
Coding >OphauB2|1377
ATGTCTAATCGCTACGGCACCGCAATGCGCAACGGCAATGGCTACGGCAACGGCAACGGCAACGGCTACGGCAAC
GGCTATGGCAACGGTTATGGCAACGAGTATGGAAACGAGTATGGCAACGGCAAGCCGCCTCGATCAGCAGACGAC
GAATACGATCCGTACGGTGACGCTTATCCGACCGACCGATATGCCCGACGAGCAGGTCCGCCCCCCGTGCTCCGT
AATCGCCCCTCGCGCTCGCGTGTGCGTGAGACGAGCGCCGAGCGACAGATTACTCAAGTTCTTGAGCACATCCGC
AGCGAGTGGCCGTCCATGTGCGAGAGTGACTGCGTTCCAGTCCAACTCGCTCTGCAGCTCCTCGATTCGAGCTCG
GTGGGTCGTGCACACGACTATCGCAAGTTTCAGCAGACGCACGCCTATCTGCAGGACTCGCTCAAGAATATTGTT
CATGAACATCACCAGGGCTTCAACAGCTCCATTGGCACTTTTCACAAGATTCAAGGCAGTATTCAAATGTCCCAG
AAGCGTGTACGAGCTCTCAAGGAATCCCTCGGCGGTGCCAAGTCTAGCCTCTGCACCACAGATACGGGCCTCAAG
AAACTGTCTGAGACGTCCCAAGTCTATGACGAGTTGCTACAGACGCTCAACGAACTCGACGAGTTGCGCGCCGTT
CCCGATCAACTAGAGGCCCGCATCTCGGAGAAGCGATTTCTTTCCGCCATTGACGTGCTACACAACGCTCTTCGC
AAACTTGGACGCCCCGAGCTCGACGACATTGGCGCTTTGAGTGATCTCAGAACCTATCTTAGCAATCAAGAGGTG
GCCCTAGTGGACATTCTTGTCGAGGAACTGCATGAACACTTATATCTCAAGTCCCCCTACTGTCAGGACAGGTGG
CAAAGTCTGTCCAAGAGCCAGGGCGCCTTTGCCGACGGTTATGGGGACGGCAACTCAATACTGCCCTTTCACCTC
GTGCTCGAATCGGTAGATCTAGACAAGTCTGTCACAGAGGATCCCATGAAGAATCCTGAAGCCGACACATTCTAC
TACATCAGTCTGCTCGTTGAGGGGCTCAACAAGCTTGGCAGACTGCAGAGCGCCGTTGAAATTCTCAAACAAAGA
CTGCCTGTGGAGCTATTTGGTGTCGTCAATGAAACCATCAATGAGGTCGACCAACGACATCCAAGCTCACTCAGA
GGCGGAGCTGGCAAGACGGAACAAGTACGCCTGTACGGCAGCCGAGAGACGCAGCTGCGCGCCGACGTCATCTAC
GACCTGCTGTGGACACTGTATGGCAAGTTTGAAGCCATTGGGGAGGGTCATCGTGTATTCCACGAATCCATAAAG
TCGCTCATTCGGCGCGAGGGCGCTGGTAATAATAGCGCTCTGCTGGGCAGTTTTAAAGAGCTGTGGAATCTTTAT
CAAAACGAAATTCGCTCTCTGCTGCACAACTATGTCACGACGGATGCCGACGTCTATCAATTTGACTCGCCTGCA
ACTGGAGGAGCCATGAATGGCAAAAAAGAGACGATGCGCGAGCACTTGTTCAAGTTTTCAGAGGCAGACTCCAAG
TCGGTGGACATGACAACAGAGTATGACGCTCTCGAGGGCATCATCCAAGCGACGGTGCCGGGGCTCACTAGCAAC
TCGCGCAAGACTGACGCCAAGAGGAATCGGGCTGTCATTGAAGGGGGAATTTCGCGGCGCGATAGAGCGTCGGGG
CTTGGGGCCGCTCGGCAAACGGTGGGCTCCTACAGGTCGCTTGTCGATCCAAGCGTCTTCAACATGAGTATTCTG
CTGCCTCCAACGCTCGTCTTCTTGCAGCGGTTAAAGAGCATCGTGCCGCCGGGATCCGATCTAGCAACTGGTGCG
CTCACGACATTTCTTGACAACTTTCTTGTCAATGTGTTTCAGCCTCAGCTGGATGAGACGCTGGGAAAGCTCAGC
GAGACAGTCTTGGGCGTCAGCGGCTCCTTTTCGCAAGACCCTGCGTGGAGGCAGTGGGCACCGAGACCCGTCTTC
AAGGGGGTGACAGCCTTTTTCGAGGTAGTGACGGCCTTTTGCCGGATGCTGGGCACCATACCGCCAGACCAGGCG
CTCAGCTCGCTCATTGTCACCCAAATGCTGCGCTACTACGATAGATGTTTTGGCTGGTACCGCTCTCTGGTGACC
AAGACCCAGGACCAGGCTACCGACTCGAGCAATCTGAGGGCGTCTGCGCGCTTTTCTCTGCAGCCGGGCGAGGTG
CAGGAGACGATGAAGAGGCTGTGGACCTCTGAAGAACTAGACAAGGAGCTACTGGACAAGGAGGTGCATTTGCTC
ATTGAAAATACCAATGAGAATCGACTCGAGATGGACGATGTGATTCAAGACCGAGATACCATCTCATCACTCTGT
CTTTTATATACCAGCATGAAGTGGTTGGCAGCCAAGGTGTCTGGGCTTAGGCACATAACGCAGCACGAGACCGAC
TCTTCCCGGCAGTCGCTTCCAAAGCGGGCGAGCCGGCGCTGGACGCTGATGAACGACCCTAACAAGGCGGTCTCG
GACCAGGGGCCGGTATATCTGCCGCTGACACAGGAGACGGTGCAGACCTTTGACAATATAATAACATCTTACGAG
GAGCTGGCTGGGACGGCTTTGTTGACACTGCACATGGAGGTTCGATGCCGCATCGCCTACTCTTTGCGCATGGCG
CTATCGCCCGACGTGGCGCCATATCTGCTGGAGCACGAAGTGAGGGAGCCGGACCCGCAAATCCTTAGCCTCAAT
CTAGAACTTGTACTATTTGACGAGACGGTGGTGCGCTTCCTGCGAGAGCGCGAGATTGATTTCATCCGGACGGGA
CTGGGCCTGCTCATCAACTGCTATCTGGTGAGCAACGCATGGATGGCGTCGCCCATGAACAGCAAGGGCTGTGGC
CGGATGCAGCTCAATATATTGGTGCTGCAGCAGAATCTGAAGAATATTGAAGAAGGGGTGGACCTGGGACGAGCA
GCCGACTACTTTGGTCTCTATGACCAGGGTCCCGATGCAATTATCAAGCGAGCACAGCTAGACAAGGAGCAGGAA
GGCGGCGGCGAGAGCTTCACGTACGAGGAGCTCAAGGCGCTTGTCGAGCTGTGCTACAGTGAGCAACTGGCCAAC
CCGGAGAGAGGCATTGCGTCTGCGGCCAAGAGGAAGATGGATGACAAACTGCTGGCCTTGAGCGAGCACCTATGG
CAGACGTGA
Transcript >OphauB2|1377
ATGTCTAATCGCTACGGCACCGCAATGCGCAACGGCAATGGCTACGGCAACGGCAACGGCAACGGCTACGGCAAC
GGCTATGGCAACGGTTATGGCAACGAGTATGGAAACGAGTATGGCAACGGCAAGCCGCCTCGATCAGCAGACGAC
GAATACGATCCGTACGGTGACGCTTATCCGACCGACCGATATGCCCGACGAGCAGGTCCGCCCCCCGTGCTCCGT
AATCGCCCCTCGCGCTCGCGTGTGCGTGAGACGAGCGCCGAGCGACAGATTACTCAAGTTCTTGAGCACATCCGC
AGCGAGTGGCCGTCCATGTGCGAGAGTGACTGCGTTCCAGTCCAACTCGCTCTGCAGCTCCTCGATTCGAGCTCG
GTGGGTCGTGCACACGACTATCGCAAGTTTCAGCAGACGCACGCCTATCTGCAGGACTCGCTCAAGAATATTGTT
CATGAACATCACCAGGGCTTCAACAGCTCCATTGGCACTTTTCACAAGATTCAAGGCAGTATTCAAATGTCCCAG
AAGCGTGTACGAGCTCTCAAGGAATCCCTCGGCGGTGCCAAGTCTAGCCTCTGCACCACAGATACGGGCCTCAAG
AAACTGTCTGAGACGTCCCAAGTCTATGACGAGTTGCTACAGACGCTCAACGAACTCGACGAGTTGCGCGCCGTT
CCCGATCAACTAGAGGCCCGCATCTCGGAGAAGCGATTTCTTTCCGCCATTGACGTGCTACACAACGCTCTTCGC
AAACTTGGACGCCCCGAGCTCGACGACATTGGCGCTTTGAGTGATCTCAGAACCTATCTTAGCAATCAAGAGGTG
GCCCTAGTGGACATTCTTGTCGAGGAACTGCATGAACACTTATATCTCAAGTCCCCCTACTGTCAGGACAGGTGG
CAAAGTCTGTCCAAGAGCCAGGGCGCCTTTGCCGACGGTTATGGGGACGGCAACTCAATACTGCCCTTTCACCTC
GTGCTCGAATCGGTAGATCTAGACAAGTCTGTCACAGAGGATCCCATGAAGAATCCTGAAGCCGACACATTCTAC
TACATCAGTCTGCTCGTTGAGGGGCTCAACAAGCTTGGCAGACTGCAGAGCGCCGTTGAAATTCTCAAACAAAGA
CTGCCTGTGGAGCTATTTGGTGTCGTCAATGAAACCATCAATGAGGTCGACCAACGACATCCAAGCTCACTCAGA
GGCGGAGCTGGCAAGACGGAACAAGTACGCCTGTACGGCAGCCGAGAGACGCAGCTGCGCGCCGACGTCATCTAC
GACCTGCTGTGGACACTGTATGGCAAGTTTGAAGCCATTGGGGAGGGTCATCGTGTATTCCACGAATCCATAAAG
TCGCTCATTCGGCGCGAGGGCGCTGGTAATAATAGCGCTCTGCTGGGCAGTTTTAAAGAGCTGTGGAATCTTTAT
CAAAACGAAATTCGCTCTCTGCTGCACAACTATGTCACGACGGATGCCGACGTCTATCAATTTGACTCGCCTGCA
ACTGGAGGAGCCATGAATGGCAAAAAAGAGACGATGCGCGAGCACTTGTTCAAGTTTTCAGAGGCAGACTCCAAG
TCGGTGGACATGACAACAGAGTATGACGCTCTCGAGGGCATCATCCAAGCGACGGTGCCGGGGCTCACTAGCAAC
TCGCGCAAGACTGACGCCAAGAGGAATCGGGCTGTCATTGAAGGGGGAATTTCGCGGCGCGATAGAGCGTCGGGG
CTTGGGGCCGCTCGGCAAACGGTGGGCTCCTACAGGTCGCTTGTCGATCCAAGCGTCTTCAACATGAGTATTCTG
CTGCCTCCAACGCTCGTCTTCTTGCAGCGGTTAAAGAGCATCGTGCCGCCGGGATCCGATCTAGCAACTGGTGCG
CTCACGACATTTCTTGACAACTTTCTTGTCAATGTGTTTCAGCCTCAGCTGGATGAGACGCTGGGAAAGCTCAGC
GAGACAGTCTTGGGCGTCAGCGGCTCCTTTTCGCAAGACCCTGCGTGGAGGCAGTGGGCACCGAGACCCGTCTTC
AAGGGGGTGACAGCCTTTTTCGAGGTAGTGACGGCCTTTTGCCGGATGCTGGGCACCATACCGCCAGACCAGGCG
CTCAGCTCGCTCATTGTCACCCAAATGCTGCGCTACTACGATAGATGTTTTGGCTGGTACCGCTCTCTGGTGACC
AAGACCCAGGACCAGGCTACCGACTCGAGCAATCTGAGGGCGTCTGCGCGCTTTTCTCTGCAGCCGGGCGAGGTG
CAGGAGACGATGAAGAGGCTGTGGACCTCTGAAGAACTAGACAAGGAGCTACTGGACAAGGAGGTGCATTTGCTC
ATTGAAAATACCAATGAGAATCGACTCGAGATGGACGATGTGATTCAAGACCGAGATACCATCTCATCACTCTGT
CTTTTATATACCAGCATGAAGTGGTTGGCAGCCAAGGTGTCTGGGCTTAGGCACATAACGCAGCACGAGACCGAC
TCTTCCCGGCAGTCGCTTCCAAAGCGGGCGAGCCGGCGCTGGACGCTGATGAACGACCCTAACAAGGCGGTCTCG
GACCAGGGGCCGGTATATCTGCCGCTGACACAGGAGACGGTGCAGACCTTTGACAATATAATAACATCTTACGAG
GAGCTGGCTGGGACGGCTTTGTTGACACTGCACATGGAGGTTCGATGCCGCATCGCCTACTCTTTGCGCATGGCG
CTATCGCCCGACGTGGCGCCATATCTGCTGGAGCACGAAGTGAGGGAGCCGGACCCGCAAATCCTTAGCCTCAAT
CTAGAACTTGTACTATTTGACGAGACGGTGGTGCGCTTCCTGCGAGAGCGCGAGATTGATTTCATCCGGACGGGA
CTGGGCCTGCTCATCAACTGCTATCTGGTGAGCAACGCATGGATGGCGTCGCCCATGAACAGCAAGGGCTGTGGC
CGGATGCAGCTCAATATATTGGTGCTGCAGCAGAATCTGAAGAATATTGAAGAAGGGGTGGACCTGGGACGAGCA
GCCGACTACTTTGGTCTCTATGACCAGGGTCCCGATGCAATTATCAAGCGAGCACAGCTAGACAAGGAGCAGGAA
GGCGGCGGCGAGAGCTTCACGTACGAGGAGCTCAAGGCGCTTGTCGAGCTGTGCTACAGTGAGCAACTGGCCAAC
CCGGAGAGAGGCATTGCGTCTGCGGCCAAGAGGAAGATGGATGACAAACTGCTGGCCTTGAGCGAGCACCTATGG
CAGACGTGA
Gene >OphauB2|1377
ATGTCTAATCGCTACGGCACCGCAATGCGCAACGGCAATGGCTACGGCAACGGCAACGGCAACGGCTACGGCAAC
GGCTATGGCAACGGTTATGGCAACGAGTATGGAAACGAGTATGGCAACGGCAAGCCGCCTCGATCAGCAGACGAC
GAATACGATCCGTACGGTGACGCTTATCCGACCGACCGATATGCCCGACGAGCAGGTCCGCCCCCCGTGCTCCGT
AATCGCCCCTCGCGCTCGCGTGTGCGTGAGACGAGCGCCGAGCGACAGATTACTCAAGTTCTTGAGCACATCCGC
AGCGAGTGGCCGTCCATGTGCGAGAGTGACTGCGTTCCAGTCCAACTCGCTCTGCAGCTCCTCGATTCGAGCTCG
GTGGGTCGTGCACACGACTATCGCAAGTTTCAGCAGACGCACGCCTATCTGCAGGACTCGCTCAAGAATATTGTT
CATGAACATCACCAGGGCTTCAACAGCTCCATTGGCACTTTTCACAAGATTCAAGGCAGTATTCAAATGTCCCAG
AAGCGTGTACGAGCTCTCAAGGAATCCCTCGGCGGTGCCAAGTCTAGCCTCTGCACCACAGATACGGGCCTCAAG
AAACTGTCTGAGACGTCCCAAGTCTATGACGAGTTGCTACAGACGCTCAACGAACTCGACGAGTTGCGCGCCGTT
CCCGATCAACTAGAGGCCCGCATCTCGGAGAAGCGATTTCTTTCCGCCATTGACGTGCTACACAACGCTCTTCGC
AAACTTGGACGCCCCGAGCTCGACGACATTGGCGCTTTGAGTGATCTCAGAACCTATCTTAGCAATCAAGAGGTG
GCCCTAGTGGACATTCTTGTCGAGGAACTGCATGAACACTTATATCTCAAGTCCCCCTACTGTCAGGACAGGTGG
CAAAGTCTGTCCAAGAGCCAGGGCGCCTTTGCCGACGGTTATGGGGACGGCAACTCAATACTGCCCTTTCACCTC
GTGCTCGAATCGGTAGATCTAGACAAGTCTGTCACAGAGGATCCCATGAAGAATCCTGAAGCCGACACATTCTAC
TACATCAGTCTGCTCGTTGAGGGGCTCAACAAGCTTGGCAGACTGCAGAGCGCCGTTGAAATTCTCAAACAAAGA
CTGCCTGTGGAGCTATTTGGTGTCGTCAATGAAACCATCAATGAGGTCGACCAACGACATCCAAGCTCACTCAGA
GGCGGAGCTGGCAAGACGGAACAAGTACGCCTGTACGGCAGCCGAGAGACGCAGCTGCGCGCCGACGTCATCTAC
GACCTGCTGTGGACACTGTATGGCAAGTTTGAAGCCATTGGGGAGGGTCATCGTGTATTCCACGAATCCATAAAG
TCGCTCATTCGGCGCGAGGGCGCTGGTAATAATAGCGCTCTGCTGGGCAGTTTTAAAGAGCTGTGGAATCTTTAT
CAAAACGAAATTCGCTCTCTGCTGCACAACTATGTCACGACGGATGCCGACGTCTATCAATTTGACTCGCCTGCA
ACTGGAGGAGCCATGAATGGCAAAAAAGAGACGATGCGCGAGCACTTGTTCAAGTTTTCAGAGGCAGACTCCAAG
TCGGTGGACATGACAACAGAGTATGACGCTCTCGAGGGCATCATCCAAGCGACGGTGCCGGGGCTCACTAGCAAC
TCGCGCAAGACTGACGCCAAGAGGAATCGGGCTGTCATTGAAGGGGGAATTTCGCGGCGCGATAGAGCGTCGGGG
CTTGGGGCCGCTCGGCAAACGGTGGGCTCCTACAGGTCGCTTGTCGATCCAAGCGTCTTCAACATGAGTATTCTG
CTGCCTCCAACGCTCGTCTTCTTGCAGCGGTTAAAGAGCATCGTGCCGCCGGGATCCGATCTAGCAACTGGTGCG
CTCACGACATTTCTTGACAACTTTCTTGTCAATGTGTTTCAGCCTCAGCTGGATGAGACGCTGGGAAAGCTCAGC
GAGACAGTCTTGGGCGTCAGCGGCTCCTTTTCGCAAGACCCTGCGTGGAGGCAGTGGGCACCGAGACCCGTCTTC
AAGGGGGTGACAGCCTTTTTCGAGGTAGTGACGGCCTTTTGCCGGATGCTGGGCACCATACCGCCAGACCAGGCG
CTCAGCTCGCTCATTGTCACCCAAATGCTGCGCTACTACGATAGATGTTTTGGCTGGTACCGCTCTCTGGTGACC
AAGACCCAGGACCAGGCTACCGACTCGAGCAATCTGAGGGCGTCTGCGCGCTTTTCTCTGCAGCCGGGCGAGGTG
CAGGAGACGATGAAGAGGCTGTGGACCTCTGAAGAACTAGACAAGGAGCTACTGGACAAGGAGGTGCATTTGCTC
ATTGAAAATACCAATGAGAATCGACTCGAGATGGACGATGTGATTCAAGACCGAGATACCATCTCATCACTCTGT
CTTTTATATACCAGCATGAAGTGGTTGGCAGCCAAGGTGTCTGGGCTTAGGCACATAACGCAGCACGAGACCGAC
TCTTCCCGGCAGTCGCTTCCAAAGCGGGCGAGCCGGCGCTGGACGCTGATGAACGACCCTAACAAGGCGGTCTCG
GACCAGGGGCCGGTATATCTGCCGCTGACACAGGAGACGGTGCAGTAAGTCGAAAAATGGCGTCGAGAAATGCAA
CTTGGCAACTGACAGCGGACAGGACCTTTGACAATATAATAACATCTTACGAGGAGCTGGCTGGGACGGCTTTGT
TGACACTGCACATGGAGGTTCGATGCCGCATCGCCTACTCTTTGCGCATGGCGCTATCGCCCGACGTGGCGCCAT
ATCTGCTGGAGCACGAAGTGAGGGAGCCGGACCCGCAAATCCTTAGCCTCAATCTAGAACTTGTACTATTTGACG
AGACGGTGGTGCGCTTCCTGCGAGAGCGCGAGATTGATTTCATCCGGACGGGACTGGGCCTGCTCATCAACTGCT
ATCTGGTGAGCAACGCATGGATGGCGTCGCCCATGAACAGCAAGGGCTGTGGCCGGATGCAGCTCAATATATTGG
TGCTGCAGCAGAATCTGAAGAATATTGAAGAAGGGGTGGACCTGGGACGAGCAGCCGACTACTTTGGTCTCTATG
ACCAGGGTCCCGATGCAATTATCAAGCGAGCACAGCTAGACAAGGAGCAGGAAGGCGGCGGCGAGAGCTTCACGT
ACGAGGAGCTCAAGGCGCTTGTCGAGCTGTGCTACAGTGAGCAACTGGCCAACCCGGAGAGAGGCATTGCGTCTG
CGGCCAAGAGGAAGATGGATGACAAACTGCTGGCCTTGAGCGAGCACCTATGGCAGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail