Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1374
Gene name
LocationContig_135:30922..31608
Strand+
Gene length (bp)686
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like 1.1E-13 58 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P54121|AIG2_ARATH Protein AIG2 OS=Arabidopsis thaliana GN=AIG2 PE=2 SV=1 64 164 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1374
MSGENTAFFYGTHSGRLIGLWLLLGSCLLMVSAWQMAPEVFFSVCIGSSSPPKAICDLYTFTPAILHEHCRHRIC
GVDYPAVVPEKGHSVRGIYATGLTDANIDKLDMFEGSEYERVKVKVQLLNSEGHEAADGSRDTFVYIFILPELLD
RREWDYDEFRREKMMINGWTRGERHFVHGVEGETANENSV*
Coding >OphauB2|1374
ATGAGTGGAGAGAACACGGCCTTCTTTTACGGCACGCACTCTGGTAGACTCATTGGGCTGTGGTTGCTTCTTGGC
AGTTGTTTGCTGATGGTTTCTGCTTGGCAGATGGCCCCAGAGGTCTTCTTCAGTGTGTGCATTGGCAGTTCTAGC
CCGCCCAAGGCTATTTGCGACCTCTACACTTTTACTCCTGCCATTCTCCATGAACATTGCCGCCATCGCATTTGC
GGTGTTGACTATCCCGCGGTTGTGCCCGAAAAGGGGCATAGCGTCCGTGGTATATACGCAACAGGCTTGACTGAT
GCCAACATTGATAAGCTTGATATGTTTGAGGGGTCGGAATATGAGCGAGTCAAAGTCAAGGTCCAGCTGCTCAAC
AGTGAGGGGCATGAGGCTGCTGATGGTAGCAGAGACACCTTCGTCTATATTTTCATCTTGCCTGAATTGCTAGAC
CGGCGTGAGTGGGACTATGACGAATTCCGTAGGGAAAAGATGATGATTAATGGATGGACCCGAGGCGAGAGGCAC
TTTGTCCATGGTGTTGAGGGCGAGACGGCCAACGAGAACTCGGTTTGA
Transcript >OphauB2|1374
ATGAGTGGAGAGAACACGGCCTTCTTTTACGGCACGCACTCTGGTAGACTCATTGGGCTGTGGTTGCTTCTTGGC
AGTTGTTTGCTGATGGTTTCTGCTTGGCAGATGGCCCCAGAGGTCTTCTTCAGTGTGTGCATTGGCAGTTCTAGC
CCGCCCAAGGCTATTTGCGACCTCTACACTTTTACTCCTGCCATTCTCCATGAACATTGCCGCCATCGCATTTGC
GGTGTTGACTATCCCGCGGTTGTGCCCGAAAAGGGGCATAGCGTCCGTGGTATATACGCAACAGGCTTGACTGAT
GCCAACATTGATAAGCTTGATATGTTTGAGGGGTCGGAATATGAGCGAGTCAAAGTCAAGGTCCAGCTGCTCAAC
AGTGAGGGGCATGAGGCTGCTGATGGTAGCAGAGACACCTTCGTCTATATTTTCATCTTGCCTGAATTGCTAGAC
CGGCGTGAGTGGGACTATGACGAATTCCGTAGGGAAAAGATGATGATTAATGGATGGACCCGAGGCGAGAGGCAC
TTTGTCCATGGTGTTGAGGGCGAGACGGCCAACGAGAACTCGGTTTGA
Gene >OphauB2|1374
ATGAGTGGAGAGAACACGGCCTTCTTTTACGGCACGTATGTCGAATTTCTTCTAAACGATGGAGCACTGACGTGG
AATTTCATTCAGGCACTCTGGTAGACTCATTGGGCTGTGGTTGCTTCTTGGCAGTTGTTTGCTGATGGTTTCTGC
TTGGCAGATGGCCCCAGAGGTCTTCTTCAGTGTGTGCATTGGCAGTTCTAGCCCGCCCAAGGCTATTTGCGACCT
CTACACTTTTACTCCTGCCATTCTCCATGAACATTGCCGCCATCGCATTTGCGGTGTTGACTATCCCGCGGTTGT
GCCCGAAAAGGGGCATAGCGTCCGTGGTATATACGCAACAGGCTTGACTGATGCCAACATTGATAAGCTTGATAT
GTTTGAGGGGTCGGAATATGAGCGAGTCAAAGTCAAGGTCCAGCTGCTCAACAGTGAGGGGCATGAGGCTGCTGA
TGGTAGCAGAGACACCTTCGTCTATATTTTCATCTTGCCTGAATTGCTAGACCGGCGTGAGTGGGACTATGACGA
ATTCCGTAGGGAAAAGATGATGATTAATGGATGGACCCGAGGCGAGAGGCACTTTGTCCATGGTTAGTATCTCTT
GCCCTCGCGTCATCAGAGGCGGCTTCTGTACTAATCAATGTGAGGCAGGTGTTGAGGGCGAGACGGCCAACGAGA
ACTCGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail