Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1373
Gene name
LocationContig_135:18387..30140
Strand-
Gene length (bp)11753
Transcript length (bp)10710
Coding sequence length (bp)10710
Protein length (aa) 3570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20206 Tra1_ring Tra1 HEAT repeat ring region 1.7E-302 894 1985
PF20206 Tra1_ring Tra1 HEAT repeat ring region 1.1E-07 2014 2190
PF20206 Tra1_ring Tra1 HEAT repeat ring region 1.8E-25 2243 2338
PF20175 Tra1_central Tra1 HEAT repeat central region 2.7E-219 288 882
PF02259 FAT FAT domain 4.2E-65 2559 2891
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 2.1E-28 3244 3499
PF02260 FATC FATC domain 3.1E-07 3538 3569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 2402 3569 0.0E+00
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 12 2154 0.0E+00
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 6 3569 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 2405 3569 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 5 1608 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 2402 3569 0.0E+00
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 12 2154 0.0E+00
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 6 3569 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 2405 3569 0.0E+00
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 5 1608 0.0E+00
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 10 1984 0.0E+00
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 319 1984 9.0E-156
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 2393 3569 1.0E-152
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 2393 3569 4.0E-146
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 2393 3569 3.0E-136
sp|G5EEV2|TRR1_CAEEL Transcription-associated protein 1 OS=Caenorhabditis elegans GN=trr-1 PE=2 SV=1 4 1304 4.0E-77
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 211 923 1.0E-74
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 2421 2928 2.0E-59
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 1295 2009 5.0E-58
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 611 1228 3.0E-50
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 1308 1984 2.0E-35
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 35 468 5.0E-27
sp|G5EEV2|TRR1_CAEEL Transcription-associated protein 1 OS=Caenorhabditis elegans GN=trr-1 PE=2 SV=1 2441 2957 3.0E-17
sp|A8WTE8|TRR1_CAEBR Transcription-associated protein 1 OS=Caenorhabditis briggsae GN=trr-1 PE=1 SV=2 2406 2945 9.0E-16
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 3167 3568 4.0E-15
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 3190 3515 9.0E-15
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 3173 3569 3.0E-14
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 3163 3569 4.0E-14
sp|Q54T85|TRA1_DICDI Probable transcription-associated protein 1 OS=Dictyostelium discoideum GN=tra1 PE=3 SV=2 19 159 6.0E-14
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 2242 2347 7.0E-14
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 3173 3499 9.0E-13
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 3228 3569 3.0E-12
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 3173 3499 7.0E-12
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 3190 3499 1.0E-11
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 3228 3569 1.0E-11
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 3173 3521 1.0E-11
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 3228 3497 6.0E-11
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 3173 3499 8.0E-11
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 3173 3499 6.0E-10
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 3173 3505 9.0E-10
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 3190 3499 1.0E-09
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 3212 3569 4.0E-09
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 3190 3568 1.0E-08
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 2242 2347 4.0E-08
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 3236 3568 6.0E-08
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 3203 3568 7.0E-08
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 2210 2336 2.0E-07
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 2239 2336 4.0E-07
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 3194 3568 2.0E-06
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 2236 2336 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1373
MSGTSLDDVVKRLSTSDLEAKDRLEAATSLRDSLDHYTSGQLYTVVLKRLMPVFINILRGPCIYQSNSPEQKLRH
CILEILHRLPTAPAPTEPFEPYAQETCELLMQLVRNDNEDNATLCVKITSDIMRHQHKALQAKVQDFLSLIQELF
EQMPKVVREQLDNAPSATLGQSGAPSTPGSQQTNFQSPRPASPVVSVPDLAADAQQQNRPLLRGMQSFKVLSECP
IIVVSIFQIYRATVPQNVKAFVPLIKNVLLLQANAQKQAHADAAARGQTHTGVSSGIKNRAAFGEFITAQVKTMS
FLAYIMRQYSSHLNDFLPALPNVIVRLLRDCPRDKSAARKELLIAIRHIINYNFRKLFVPIIDDLLDERTLTGDG
LTVYETMRPLAFSMLADLIHHVRDSLGPDQIRKTVEVYTKNLQDSFPGTSFQTMSAKLLLNMAECIAKLPNKVDA
RHYHMLILNAIGDKFAAMNRQYPNAVKLSKQYHQQAETGISETYLADKEHPPDWDETDIFSAVPIKISNPRDRGA
DPVVDNKFLFRNLMNGLKNTFYQLRACNVAPPIDPQFAPSHWQDVSYGFTAEEVNIIIKLFREGAHVFRYYEIEK
PVSESQYSSPVEQMANFYMISSSKEEKDLLETFATVFHCIDPATFHEVFQQEIPKLYEMIFEHTALLHIPQFFLA
SEATSPSFCGMLLQFLMEHIDEVGSADVRKSSILLRLFKLAFMAVTLFAAQNEQVLLPHVVNIVTKSIELSTKAE
EPINYFLLLRSLFRSIGGGKFEQLYKQILPLLEMLLDVLNTLLMAARKPSERDLYVELCLTVPARLSHLLPHLSF
LMRPLVVALRAGTELVGQGLRTLELCVDNLTADYLDPIMAPVIDELMSALFSHLKPHPYSHFHAHTTMRILGKLG
GRNRKFMTAAVPLTYKEYSDDASSFDVRLVGSKWDRAFPADLGIESAIQKLMEAPRTNKNPQNRQHDDFYKKQSL
HLIKSQLKLRIGYDQLPDDLPRIVRLQAQDFISKKLDINFLPFETSNRDKSIAKKDEQDQVTKNLLKAIMFAESI
PDLGEEDDAFLVEICRHFTIIEIGRALVDIKRTFNAFDPKAGEGPLFIDSRVLCDAIVESLASDHPDVREAAKKA
IREVHKTASIILGSELHVGRLPLFTHLSNTFCHSCYEEEWFTKSGGSLGINFMLTELDFGDAWVASKQTEFIRAL
MYVIKDMPQDLPEKTRRLAQETLEVLLRRITRHIKKEDAMPIAQQPGQPPPKQTRLAQICMQFNSELAHMNKFVR
ETSKQSLELIAKAAGCEVWELIDPYKERFLQPIYSKPLRALPFSTQIGYINAMTYHMSLKHDKVNLDENLNRLLM
ESLALADAQDDSLANKPAEYRTHQHIVNLRVSCIKLLSTAMTFEEFANSPTKPRILQVFFKCLYSESKPTIAAAN
DALKLVLAVDRRLPKDLLQGGLRPVLASLSDPKRLTVHGLENLSRLLKLLNSYFKVEIGVRLLDQIYSIVEPGAW
QQISFTFCEQNPQMKVITAVLNIFHLLPSPAESFKERLIENFLELEDKLRRTIQSPFRAPIYLYLNRYPKEIWKH
LVGKLHELKFGRLLAQVLSHPDSSPLREVAAEGVDALVSRCNEVMSEGGEKKFIAIVNSIHILDSISQWHNACGW
MNKKETISWLKTIGKELESHIRNYTLPADLRLPAYQAAEQLMTVLIKSLERNPTDLDSLFSLIESITGGELRATH
ALYHFLYEKIISNDSIEFWKTTVLRCLDMYAGKMVSNKTKHFLLHYIVNPIVAMDVMRHWNSGDTNKGPRFLDRS
VIDAVSSKIWKVHPDEMTAEDATQPGIDHTRFEVLQLSAMLVKYYHTTISDTRKDIIKFGWTFIRLDDVINKHAA
YVVIGYFIAHYDTPPKIVNQVYLSLLKTNQNEGRALVTQALELIAPVLPKRCSSGPADRKGCNERGTAYAQPWAM
APRRVLSDEGHNVQQMSSIFQFLVRHPELFYDVRDNKKLALNMMWLIWTKRKFEGMDQATPTSPPAVRQTGSSER
SEFQISQMFRQKMMKYLVEFIAQLNERYQLPSARPREHNPSSVPQTQPHYWGDLDIDLFPNVTDVILCGEKTQTT
LNAEPSDKEKYDERFLTNIINTLQVVRIIINFKSDDWIQRNIAAVQKVLEKNIKYDDGRLLKSIIQRVLDAVPED
APMEDADAEGETEAQTSSYISGVNLLWSLGKRKPAHYSALAAPAAGELSAYDLEIQIKLMIKEIQTVAVLATLVE
KSMNIELCTEILNMVEGWVFRSEGSWPTLKEKTAFLDLVIRIYEDPKIARTELTVRMEHAFLIGMRASDVDMRNR
FMAIFDRSLSRTASASQFLLGAIISASQLAAVYPRDGKDLREASNMADDKFELLMAGHRRFVAELGEHIDMTLAH
RLWRGMVALLTKDYHNRQMDKRPNVVQSLVEGAVKTPGCRLPPHVLKFLAKTFDVWYTALVHLEDAAVNPQKDSA
PVRESNLNALVKLYALLKEDDLFYGTWRRRCQFVETNAGLSYEQNGMWDRAQKLYETAQIKARTGRLQQWEILQD
LAKHENYQDLLLECAWRNMDMWQEAQHREACFMSLLKLHNQQETANDFARVCDEAIQLSIRKWHQLPERLTNAHV
PILQNFQQMVELHDASVICQSLANTNASNLDSKSTELKMLLAGWRERLPNVWDDITAWQDLVTWRQHIFNLINQT
YLQLLPPQNQQNAAAGANSFAYRGYHETAWIINRFAHVARKHSLPEVCISQLSRIYTLPNIEIQEAFLKLREQAK
CHYESAEELSNGLDVINNTNLSYFNQQQKAEFFTLKGMFLEKLGQKSEADSSFGTALYYDIGAAKAWAEWGYFND
RKFKEDPTDLNAARQALTSYLQAAGSYKNGKSRKLLARILWLLSIDDDKGTIAMGFDDYKGETPVWYWITFIPQL
LTGLGHKEAPRVFNILLNIAKSYPQALYFQLRTSREDMHIIKKNQEAKERARQQQAQQNRPDGSRAASRPGTANG
TASGAEATPARSDGGDAGPQSSRAGSQAQEQQPQGPGHKKHPWELTDEVMSVLKTAFPLLALSMETMVDQIQKNF
KCPPDEDAYRLIVALLNDALTYVSRTPASFAKSVKLPSATETNITRFAENILPSHIKKSFEADFVKVKPTMYEYI
HKLRRWRSKFEEKLDRRVRHAPLESFSPHLSEFRYQKFDEVEVPGQYLQHKDRNQDFIRIERFLPNVDLVRSYSA
SYRRLKMRGHDGSVHAWAVQHPAARHCRREERVAQLFRQLNQTLSRKKESRRRDLQFTLPLMVPLAPHIRIVQED
TSYVTLQAVYEDHCRLVGLRKDEPVLFTLDKLRGVLESKNQLGKAELAPAARLEVMKAVQAKWVPGTVALEYFQQ
VFPQFAEFWLFRRQFSYQLAALSFMTYIVFMQNRNPFKMSISRASGNIWGSELISFMSVTKPLFVSVEPVPFRLT
PSLQVLMGPLATEGIFGCSLMAIARCLTEPQQELEHALTLFVRDEVICWMTSSHRNAISENQLRESVQVNSDSIL
KRALSLAHNPSGNLPANQTVIDAISKAVNPMNLAQCDALWMPYL*
Coding >OphauB2|1373
ATGTCGGGGACCTCTCTCGACGACGTCGTCAAGCGTCTTAGCACGTCCGACCTTGAGGCGAAAGATCGGTTGGAG
GCCGCCACATCTCTGCGCGACAGTCTAGATCACTATACTAGCGGCCAGTTATATACAGTTGTCCTTAAACGCTTG
ATGCCAGTATTTATCAACATCTTGCGCGGACCATGCATTTATCAAAGCAACTCCCCAGAACAGAAACTTCGTCAC
TGTATTCTCGAAATCCTCCACCGACTACCAACTGCGCCTGCACCTACAGAACCATTTGAACCTTATGCTCAAGAG
ACATGTGAGCTGCTCATGCAGCTTGTACGGAACGACAACGAAGACAATGCGACTCTCTGCGTCAAGATTACGTCG
GACATTATGCGCCATCAACACAAGGCTCTTCAGGCCAAGGTCCAAGACTTTCTCTCTCTTATTCAAGAGCTTTTC
GAACAGATGCCCAAAGTGGTAAGGGAGCAGCTTGACAATGCTCCCTCGGCGACGTTGGGACAATCTGGCGCGCCA
TCAACCCCCGGAAGTCAGCAGACCAACTTCCAGTCGCCTCGGCCTGCTTCGCCTGTTGTTTCCGTTCCGGATCTA
GCGGCGGATGCCCAACAGCAAAACCGCCCCCTCTTGAGAGGAATGCAGTCTTTCAAAGTTTTGTCGGAATGTCCC
ATCATCGTTGTCTCCATTTTCCAAATCTACCGAGCAACAGTGCCCCAGAACGTCAAGGCTTTTGTTCCACTCATC
AAAAACGTCCTCTTGCTGCAGGCCAACGCTCAGAAGCAAGCTCACGCGGATGCAGCCGCCAGAGGTCAGACACAT
ACTGGCGTAAGTTCTGGGATCAAGAATCGTGCGGCTTTTGGCGAATTCATCACGGCTCAGGTTAAGACTATGAGC
TTTTTGGCCTATATCATGCGACAGTATTCATCACATCTTAACGATTTTCTGCCGGCGCTACCAAACGTCATTGTC
CGCCTCCTCAGAGACTGTCCTCGCGACAAATCTGCTGCTCGAAAAGAGCTACTCATTGCCATACGCCACATTATA
AATTACAATTTTCGCAAACTCTTCGTACCCATTATTGATGACCTGCTGGACGAGCGAACCTTGACTGGAGATGGC
TTAACAGTTTATGAAACCATGAGGCCTTTGGCTTTCAGCATGTTGGCCGATTTAATCCATCACGTACGAGACTCG
CTGGGCCCAGACCAGATCCGCAAGACTGTTGAAGTCTACACCAAAAATCTCCAGGACAGCTTTCCGGGAACTAGC
TTTCAAACAATGAGTGCCAAGCTACTTCTCAACATGGCGGAGTGTATTGCAAAGCTACCAAACAAAGTCGACGCT
AGGCATTACCACATGCTTATCCTCAATGCAATAGGGGATAAGTTTGCAGCCATGAATCGGCAGTATCCGAATGCC
GTCAAACTTTCCAAGCAGTACCACCAACAGGCAGAGACGGGCATCTCTGAGACGTATTTGGCCGACAAGGAACAT
CCCCCAGACTGGGATGAGACGGATATATTTTCTGCCGTGCCCATCAAGATTTCCAACCCTCGCGATAGGGGCGCC
GACCCAGTGGTGGATAATAAGTTTCTGTTTCGGAATCTTATGAATGGCCTGAAGAATACTTTTTACCAACTACGC
GCCTGCAACGTTGCCCCTCCAATCGATCCGCAGTTTGCTCCCTCGCATTGGCAGGACGTGTCCTATGGCTTCACG
GCTGAAGAAGTCAACATAATCATCAAATTGTTTCGGGAGGGTGCTCACGTTTTCAGATACTACGAGATTGAGAAG
CCAGTGTCGGAATCCCAATACTCGTCTCCAGTTGAACAAATGGCAAATTTCTACATGATTTCTAGCAGCAAAGAG
GAGAAGGATTTACTCGAGACGTTCGCTACTGTCTTCCACTGCATTGACCCAGCAACTTTTCACGAAGTTTTCCAG
CAAGAGATACCAAAACTGTATGAAATGATCTTCGAGCATACAGCGCTGTTGCACATTCCGCAATTCTTCCTTGCC
AGCGAAGCGACTTCACCCAGCTTCTGTGGCATGCTTCTTCAATTTCTCATGGAGCATATCGACGAAGTTGGCTCT
GCAGATGTGAGGAAGTCATCGATTCTACTGAGGCTCTTCAAGCTTGCTTTCATGGCGGTCACACTCTTTGCAGCA
CAAAACGAGCAAGTCCTTCTCCCACATGTGGTTAACATTGTCACAAAATCTATTGAATTGTCAACAAAGGCTGAG
GAGCCTATTAATTACTTTCTCCTTCTCCGTTCGCTCTTTCGAAGCATTGGGGGAGGCAAATTCGAACAGCTTTAC
AAGCAAATTTTGCCATTGCTTGAAATGCTCTTGGACGTCCTCAATACGTTGCTCATGGCTGCGCGGAAGCCTTCG
GAGCGGGATCTGTATGTGGAGCTTTGCCTCACTGTGCCCGCCCGGCTCAGCCACTTGCTTCCACATCTGAGCTTC
CTCATGCGACCTCTTGTTGTTGCGCTGCGTGCAGGAACAGAGCTTGTTGGTCAGGGACTACGCACGCTCGAGCTA
TGCGTCGACAATCTGACTGCCGACTACCTGGATCCCATCATGGCGCCAGTAATTGATGAGCTCATGAGCGCGCTT
TTCAGTCACTTGAAGCCGCATCCATACAGCCATTTCCATGCTCATACCACGATGCGAATTCTGGGCAAGTTGGGC
GGTCGAAATAGGAAGTTTATGACTGCTGCTGTGCCGCTGACTTACAAGGAATACTCTGACGATGCTTCGAGCTTT
GACGTACGGCTTGTTGGCTCTAAATGGGACCGAGCTTTTCCGGCCGATCTTGGCATAGAATCGGCCATCCAGAAG
TTGATGGAGGCACCGCGAACCAACAAGAACCCTCAGAATCGCCAACATGACGACTTTTACAAGAAGCAGAGTCTT
CATCTGATCAAGTCACAGCTGAAGTTGCGCATCGGCTATGACCAGCTGCCGGACGACTTGCCCCGCATTGTGCGT
CTTCAGGCCCAAGATTTTATATCCAAGAAGCTTGACATCAATTTCTTGCCTTTTGAAACATCGAATCGTGACAAG
TCGATTGCCAAGAAGGACGAGCAGGATCAAGTGACCAAGAACTTACTCAAGGCCATCATGTTTGCCGAGTCAATA
CCAGACCTCGGCGAGGAAGATGACGCATTCCTGGTCGAAATTTGCAGACATTTCACCATTATTGAGATTGGCCGA
GCCTTGGTAGATATTAAGCGCACATTCAATGCTTTCGATCCCAAGGCTGGTGAAGGCCCTCTGTTTATTGATTCA
AGGGTTCTTTGCGACGCAATAGTCGAGTCGCTTGCATCTGACCATCCTGATGTGCGAGAGGCAGCAAAAAAGGCA
ATTCGAGAAGTGCACAAGACTGCAAGCATCATCTTGGGGTCGGAACTACATGTTGGCCGTTTACCCTTGTTCACA
CATTTGAGCAATACATTCTGCCACAGCTGCTACGAGGAGGAATGGTTCACCAAATCGGGAGGCAGTCTGGGTATC
AATTTTATGCTTACAGAACTCGACTTTGGCGACGCGTGGGTAGCTTCGAAGCAGACCGAGTTCATTCGGGCTCTC
ATGTACGTCATCAAGGACATGCCACAGGATTTGCCGGAAAAGACTAGGCGACTAGCCCAAGAGACGCTCGAGGTT
CTTTTGCGTCGCATCACCAGGCACATCAAGAAGGAAGACGCCATGCCGATAGCACAGCAACCGGGCCAGCCTCCC
CCAAAACAGACGCGCCTTGCCCAAATTTGCATGCAGTTCAATAGCGAGCTTGCCCACATGAACAAGTTTGTTCGC
GAAACGTCAAAACAGTCGCTCGAGTTGATAGCAAAGGCTGCTGGCTGTGAAGTATGGGAGCTGATTGACCCTTAC
AAGGAGCGATTTCTCCAACCCATTTACTCCAAGCCGCTGCGAGCATTGCCTTTTAGCACGCAAATTGGCTACATC
AACGCCATGACGTATCATATGAGCCTCAAGCACGACAAGGTCAACCTGGACGAGAATTTGAACCGCTTACTTATG
GAGTCTTTGGCTCTGGCAGACGCCCAGGATGACTCGCTCGCCAACAAGCCGGCTGAATACAGGACCCATCAGCAC
ATTGTCAACTTGCGTGTTTCTTGCATCAAGCTTCTCAGCACTGCCATGACATTTGAAGAGTTTGCAAACAGCCCT
ACCAAGCCAAGGATCCTCCAGGTCTTTTTCAAGTGTCTGTACTCCGAGTCAAAACCGACCATAGCGGCAGCCAAC
GACGCTCTCAAGCTGGTGCTGGCGGTGGATAGGCGTTTGCCAAAGGATCTGCTGCAAGGCGGTCTACGCCCGGTT
CTGGCCAGTCTGTCTGATCCCAAACGCCTCACTGTCCATGGCCTCGAAAACCTTTCGAGACTTTTGAAACTGCTC
AATAGCTATTTCAAGGTGGAGATTGGCGTTCGATTGTTGGATCAGATTTATTCCATTGTCGAACCCGGCGCGTGG
CAGCAGATATCCTTTACCTTTTGTGAACAAAATCCTCAAATGAAAGTCATTACCGCCGTCCTCAACATTTTCCAC
CTGCTGCCTTCCCCGGCCGAATCCTTCAAGGAGCGACTCATTGAAAACTTCCTCGAGCTTGAAGATAAGCTTAGG
AGAACTATTCAGAGTCCCTTTCGCGCTCCCATATACTTGTATCTGAACAGATACCCAAAGGAAATTTGGAAGCAC
CTGGTTGGAAAGCTGCATGAGCTCAAGTTTGGGCGACTGCTTGCCCAAGTCCTCAGTCATCCAGACAGCTCTCCC
CTGCGAGAGGTGGCTGCCGAAGGTGTGGATGCATTGGTCAGCCGATGCAACGAGGTGATGAGCGAGGGCGGCGAG
AAGAAGTTTATTGCCATTGTCAACTCGATCCACATTCTTGACTCAATCAGTCAGTGGCACAATGCTTGCGGGTGG
ATGAACAAGAAGGAAACGATATCGTGGCTCAAGACGATTGGAAAGGAGCTCGAGAGCCATATTCGGAACTACACA
CTGCCTGCGGACCTCCGTTTGCCGGCATATCAAGCCGCTGAACAGTTGATGACGGTCTTGATCAAGTCTCTGGAG
AGGAACCCAACCGACTTGGATTCTCTCTTTAGTCTAATTGAGTCGATTACTGGCGGAGAGCTGCGCGCAACCCAC
GCCCTCTACCACTTTTTGTACGAGAAGATTATCAGTAACGACTCAATCGAATTCTGGAAGACGACGGTTTTGCGC
TGTCTCGACATGTATGCTGGCAAAATGGTGTCAAACAAGACGAAGCACTTTTTGCTGCATTACATTGTCAACCCA
ATTGTGGCGATGGATGTGATGCGCCACTGGAACAGCGGCGACACTAATAAAGGTCCGCGCTTCCTCGATCGCAGC
GTGATTGATGCTGTTAGCTCCAAGATTTGGAAGGTGCACCCAGACGAGATGACGGCCGAGGATGCAACGCAGCCA
GGCATTGATCACACACGATTTGAAGTTTTGCAGCTTTCGGCGATGCTGGTCAAGTACTACCACACGACCATTTCA
GACACACGCAAGGACATCATCAAGTTTGGCTGGACATTTATCCGGCTGGACGACGTGATCAACAAGCATGCTGCA
TATGTGGTTATTGGATACTTCATTGCCCACTATGATACGCCGCCCAAGATTGTCAATCAGGTTTACCTTTCGCTG
CTCAAGACGAACCAAAACGAAGGACGGGCGCTGGTGACGCAAGCTCTCGAACTCATTGCGCCAGTGCTGCCCAAG
CGGTGCAGCAGCGGGCCTGCAGACCGCAAGGGATGCAATGAGCGTGGTACCGCATATGCCCAGCCGTGGGCCATG
GCGCCTCGACGGGTGCTTTCTGACGAAGGGCACAATGTGCAGCAAATGTCGAGCATCTTCCAGTTTTTGGTGCGG
CATCCCGAGCTGTTTTACGACGTGAGGGACAATAAGAAGCTGGCACTCAATATGATGTGGCTCATTTGGACGAAG
CGCAAGTTTGAAGGAATGGACCAGGCTACTCCCACGTCGCCCCCGGCTGTGCGGCAAACAGGCTCGAGTGAGCGC
AGCGAATTCCAAATCAGCCAAATGTTTCGTCAAAAGATGATGAAGTATCTGGTTGAATTTATTGCCCAGCTCAAC
GAACGCTACCAGCTGCCGTCTGCACGACCTCGCGAACACAACCCGTCGTCGGTTCCGCAAACGCAGCCTCATTAC
TGGGGAGACCTTGATATCGACTTGTTTCCCAACGTGACTGATGTCATTCTGTGCGGCGAAAAGACTCAGACGACG
CTCAATGCTGAGCCGTCAGACAAGGAAAAGTATGACGAGAGGTTTCTGACAAACATCATCAATACTCTGCAGGTG
GTGCGCATAATCATCAACTTCAAATCGGACGATTGGATCCAGAGGAACATTGCGGCGGTGCAAAAGGTGTTGGAG
AAGAACATCAAGTATGACGACGGGCGCCTTCTCAAGTCGATTATCCAACGAGTCTTGGATGCCGTGCCAGAGGAT
GCGCCCATGGAAGACGCCGATGCAGAGGGCGAGACGGAAGCGCAAACCTCGTCATACATTTCTGGCGTCAACCTC
CTCTGGTCGCTGGGCAAGCGCAAGCCAGCCCATTACAGCGCGCTTGCCGCGCCTGCGGCTGGAGAGCTGTCTGCC
TATGATCTCGAGATTCAGATCAAGCTCATGATCAAGGAGATACAGACAGTGGCCGTCTTGGCGACGCTGGTGGAA
AAGTCGATGAACATTGAGCTTTGCACAGAAATCCTCAACATGGTTGAGGGTTGGGTCTTTCGGTCCGAGGGCTCG
TGGCCTACGCTCAAGGAAAAGACGGCATTCCTGGACCTCGTTATTCGCATATACGAGGATCCCAAGATTGCGCGG
ACAGAGCTGACGGTGCGCATGGAGCACGCCTTCTTGATTGGCATGAGGGCCAGCGACGTGGACATGCGAAACCGC
TTCATGGCGATTTTTGACCGCAGCCTGTCACGAACAGCCAGTGCGTCGCAGTTCTTGTTGGGGGCCATCATTTCG
GCGTCGCAGCTGGCGGCGGTCTACCCAAGAGACGGCAAGGACTTGCGCGAGGCGAGCAACATGGCTGACGACAAG
TTTGAGTTGCTCATGGCTGGCCACCGTCGATTTGTCGCTGAGCTGGGCGAGCACATTGACATGACGCTGGCTCAC
CGGCTGTGGCGCGGCATGGTGGCTCTGCTGACCAAGGACTACCACAACCGGCAAATGGATAAGAGACCCAATGTG
GTGCAGTCGCTGGTGGAGGGCGCCGTCAAGACGCCGGGGTGCAGGCTGCCGCCGCATGTGCTCAAGTTTTTGGCC
AAGACGTTTGACGTGTGGTACACGGCCCTGGTGCATCTCGAGGATGCGGCCGTCAACCCCCAAAAGGACTCGGCG
CCGGTGCGGGAGAGCAATCTCAACGCGCTGGTTAAGCTGTATGCGCTGTTGAAGGAGGATGACCTCTTTTACGGA
ACATGGCGGCGACGCTGCCAGTTTGTCGAGACCAACGCAGGCCTTTCCTACGAGCAAAACGGCATGTGGGACAGG
GCGCAGAAGCTGTATGAAACGGCGCAGATCAAGGCGAGAACGGGCCGCCTGCAGCAGTGGGAGATTTTGCAGGAT
CTGGCCAAGCACGAAAACTATCAAGACTTGCTGCTTGAATGCGCCTGGCGAAACATGGACATGTGGCAAGAGGCG
CAGCACCGCGAGGCTTGCTTCATGTCGCTGCTCAAGTTGCATAACCAGCAGGAGACGGCTAATGACTTTGCGCGG
GTTTGCGACGAGGCTATCCAGCTGTCCATTAGGAAGTGGCATCAGCTGCCTGAGCGGCTGACCAATGCCCATGTG
CCCATTTTGCAAAACTTTCAGCAAATGGTGGAGTTGCATGATGCCAGCGTTATTTGCCAGAGCCTTGCAAACACG
AATGCGTCGAATCTCGACTCCAAGTCGACTGAGCTCAAGATGTTACTTGCGGGCTGGCGCGAACGACTGCCCAAT
GTTTGGGACGACATTACGGCCTGGCAGGACCTTGTGACGTGGAGGCAGCACATTTTCAATCTCATCAACCAAACA
TATCTGCAGCTGCTTCCGCCCCAGAACCAGCAAAACGCGGCGGCCGGAGCAAACTCGTTTGCCTATCGTGGCTAC
CATGAAACGGCCTGGATAATCAACCGCTTCGCCCATGTGGCGCGCAAGCACAGCCTGCCTGAAGTGTGCATCAGC
CAACTGAGCCGCATCTACACGCTGCCAAACATTGAGATTCAGGAAGCCTTTTTGAAGTTGCGCGAGCAGGCCAAG
TGCCATTACGAGAGTGCCGAAGAACTGTCGAATGGCCTCGACGTCATCAACAATACCAATCTCAGCTACTTCAAC
CAGCAGCAAAAGGCTGAATTCTTCACTCTCAAGGGCATGTTCCTCGAAAAGCTGGGCCAAAAGAGCGAGGCTGAC
AGCTCCTTTGGCACTGCTCTCTACTACGACATTGGCGCCGCCAAGGCGTGGGCTGAATGGGGCTACTTCAACGAC
AGGAAATTCAAGGAGGACCCGACTGACCTCAATGCCGCTCGCCAGGCCTTGACGTCGTATCTGCAGGCGGCTGGC
AGCTACAAGAACGGCAAGTCGCGCAAGCTGCTGGCCCGGATTCTCTGGCTCCTCAGCATTGATGATGACAAGGGC
ACCATTGCCATGGGCTTTGACGACTACAAGGGAGAGACGCCGGTGTGGTACTGGATCACCTTTATCCCCCAGCTG
CTGACGGGACTTGGCCACAAGGAGGCGCCGCGCGTCTTCAACATTTTGCTCAATATTGCCAAGTCGTACCCACAG
GCGCTCTACTTCCAGCTGCGCACGAGCCGCGAGGACATGCACATCATCAAGAAGAACCAAGAGGCCAAGGAGCGA
GCACGCCAGCAACAGGCACAGCAAAACCGCCCAGACGGCTCCAGAGCTGCCTCGCGCCCCGGCACGGCCAATGGA
ACGGCCAGCGGGGCCGAGGCTACGCCCGCGAGGAGCGACGGAGGCGACGCGGGGCCGCAGTCGTCACGCGCGGGC
TCTCAGGCTCAAGAGCAGCAGCCACAGGGCCCCGGCCACAAGAAGCATCCCTGGGAGCTGACAGACGAGGTCATG
TCGGTCCTCAAGACGGCCTTCCCTCTCTTGGCGCTGTCCATGGAGACCATGGTGGATCAAATCCAGAAAAACTTC
AAGTGTCCGCCCGACGAGGACGCCTACCGACTCATTGTTGCCTTGCTTAATGATGCGCTGACATATGTGAGTCGC
ACGCCGGCTTCGTTTGCCAAGAGCGTCAAGCTGCCGTCGGCAACCGAGACCAACATTACCCGGTTTGCCGAGAAT
ATTCTGCCCAGCCATATAAAGAAGTCGTTTGAGGCCGACTTTGTCAAGGTGAAGCCCACCATGTATGAGTATATA
CACAAGCTGCGACGATGGCGAAGCAAATTCGAAGAGAAGCTGGATCGGCGGGTGAGGCATGCGCCCCTCGAGAGC
TTCTCGCCGCATCTAAGCGAGTTTCGCTACCAAAAGTTTGACGAGGTTGAGGTGCCGGGACAGTATCTTCAACAC
AAGGACAGAAACCAAGACTTTATTCGCATCGAGCGATTTCTGCCCAATGTGGACCTGGTGCGGTCGTATAGCGCC
TCATACCGACGGCTCAAGATGCGTGGCCACGACGGCAGTGTGCATGCGTGGGCGGTGCAGCATCCGGCAGCTCGG
CACTGTCGAAGGGAAGAGCGTGTAGCGCAGCTGTTTCGGCAGCTCAACCAGACGCTGAGCCGCAAGAAGGAAAGC
CGGCGACGCGATTTACAATTTACGCTGCCCCTCATGGTGCCGCTGGCGCCCCATATACGCATAGTGCAAGAGGAT
ACTTCGTATGTGACGCTGCAGGCTGTCTACGAGGACCACTGCAGGCTGGTTGGTCTTCGCAAGGACGAGCCTGTC
CTCTTCACCCTCGACAAGCTTCGGGGCGTGCTGGAAAGCAAAAACCAGCTGGGCAAGGCAGAGCTGGCTCCAGCG
GCACGGCTCGAGGTGATGAAGGCGGTGCAGGCCAAGTGGGTGCCTGGAACGGTTGCGCTCGAGTACTTCCAGCAA
GTCTTTCCGCAGTTTGCCGAGTTTTGGCTCTTTCGCCGGCAGTTTTCATATCAGCTGGCGGCTCTGTCCTTCATG
ACGTATATTGTCTTTATGCAGAACCGGAACCCCTTCAAGATGAGCATCTCGCGAGCGTCGGGCAATATCTGGGGC
TCGGAGCTCATCAGCTTCATGAGCGTCACCAAGCCCCTCTTTGTGAGCGTGGAGCCGGTGCCCTTTCGCCTGACG
CCCAGTCTGCAGGTGCTCATGGGACCCTTGGCAACCGAAGGCATTTTTGGCTGCTCGCTCATGGCCATTGCGCGG
TGCCTGACGGAGCCACAGCAGGAGCTGGAGCACGCCTTGACGCTGTTTGTTCGCGACGAAGTCATTTGTTGGATG
ACGAGTAGCCACCGCAACGCCATTAGCGAGAACCAGCTGCGCGAGTCTGTCCAGGTCAATAGCGACTCGATTTTG
AAACGGGCGCTTAGTTTGGCGCACAATCCATCGGGAAACCTACCGGCCAACCAGACGGTGATTGACGCCATTTCC
AAGGCGGTCAACCCCATGAACCTGGCCCAATGCGATGCGCTCTGGATGCCTTATTTATAG
Transcript >OphauB2|1373
ATGTCGGGGACCTCTCTCGACGACGTCGTCAAGCGTCTTAGCACGTCCGACCTTGAGGCGAAAGATCGGTTGGAG
GCCGCCACATCTCTGCGCGACAGTCTAGATCACTATACTAGCGGCCAGTTATATACAGTTGTCCTTAAACGCTTG
ATGCCAGTATTTATCAACATCTTGCGCGGACCATGCATTTATCAAAGCAACTCCCCAGAACAGAAACTTCGTCAC
TGTATTCTCGAAATCCTCCACCGACTACCAACTGCGCCTGCACCTACAGAACCATTTGAACCTTATGCTCAAGAG
ACATGTGAGCTGCTCATGCAGCTTGTACGGAACGACAACGAAGACAATGCGACTCTCTGCGTCAAGATTACGTCG
GACATTATGCGCCATCAACACAAGGCTCTTCAGGCCAAGGTCCAAGACTTTCTCTCTCTTATTCAAGAGCTTTTC
GAACAGATGCCCAAAGTGGTAAGGGAGCAGCTTGACAATGCTCCCTCGGCGACGTTGGGACAATCTGGCGCGCCA
TCAACCCCCGGAAGTCAGCAGACCAACTTCCAGTCGCCTCGGCCTGCTTCGCCTGTTGTTTCCGTTCCGGATCTA
GCGGCGGATGCCCAACAGCAAAACCGCCCCCTCTTGAGAGGAATGCAGTCTTTCAAAGTTTTGTCGGAATGTCCC
ATCATCGTTGTCTCCATTTTCCAAATCTACCGAGCAACAGTGCCCCAGAACGTCAAGGCTTTTGTTCCACTCATC
AAAAACGTCCTCTTGCTGCAGGCCAACGCTCAGAAGCAAGCTCACGCGGATGCAGCCGCCAGAGGTCAGACACAT
ACTGGCGTAAGTTCTGGGATCAAGAATCGTGCGGCTTTTGGCGAATTCATCACGGCTCAGGTTAAGACTATGAGC
TTTTTGGCCTATATCATGCGACAGTATTCATCACATCTTAACGATTTTCTGCCGGCGCTACCAAACGTCATTGTC
CGCCTCCTCAGAGACTGTCCTCGCGACAAATCTGCTGCTCGAAAAGAGCTACTCATTGCCATACGCCACATTATA
AATTACAATTTTCGCAAACTCTTCGTACCCATTATTGATGACCTGCTGGACGAGCGAACCTTGACTGGAGATGGC
TTAACAGTTTATGAAACCATGAGGCCTTTGGCTTTCAGCATGTTGGCCGATTTAATCCATCACGTACGAGACTCG
CTGGGCCCAGACCAGATCCGCAAGACTGTTGAAGTCTACACCAAAAATCTCCAGGACAGCTTTCCGGGAACTAGC
TTTCAAACAATGAGTGCCAAGCTACTTCTCAACATGGCGGAGTGTATTGCAAAGCTACCAAACAAAGTCGACGCT
AGGCATTACCACATGCTTATCCTCAATGCAATAGGGGATAAGTTTGCAGCCATGAATCGGCAGTATCCGAATGCC
GTCAAACTTTCCAAGCAGTACCACCAACAGGCAGAGACGGGCATCTCTGAGACGTATTTGGCCGACAAGGAACAT
CCCCCAGACTGGGATGAGACGGATATATTTTCTGCCGTGCCCATCAAGATTTCCAACCCTCGCGATAGGGGCGCC
GACCCAGTGGTGGATAATAAGTTTCTGTTTCGGAATCTTATGAATGGCCTGAAGAATACTTTTTACCAACTACGC
GCCTGCAACGTTGCCCCTCCAATCGATCCGCAGTTTGCTCCCTCGCATTGGCAGGACGTGTCCTATGGCTTCACG
GCTGAAGAAGTCAACATAATCATCAAATTGTTTCGGGAGGGTGCTCACGTTTTCAGATACTACGAGATTGAGAAG
CCAGTGTCGGAATCCCAATACTCGTCTCCAGTTGAACAAATGGCAAATTTCTACATGATTTCTAGCAGCAAAGAG
GAGAAGGATTTACTCGAGACGTTCGCTACTGTCTTCCACTGCATTGACCCAGCAACTTTTCACGAAGTTTTCCAG
CAAGAGATACCAAAACTGTATGAAATGATCTTCGAGCATACAGCGCTGTTGCACATTCCGCAATTCTTCCTTGCC
AGCGAAGCGACTTCACCCAGCTTCTGTGGCATGCTTCTTCAATTTCTCATGGAGCATATCGACGAAGTTGGCTCT
GCAGATGTGAGGAAGTCATCGATTCTACTGAGGCTCTTCAAGCTTGCTTTCATGGCGGTCACACTCTTTGCAGCA
CAAAACGAGCAAGTCCTTCTCCCACATGTGGTTAACATTGTCACAAAATCTATTGAATTGTCAACAAAGGCTGAG
GAGCCTATTAATTACTTTCTCCTTCTCCGTTCGCTCTTTCGAAGCATTGGGGGAGGCAAATTCGAACAGCTTTAC
AAGCAAATTTTGCCATTGCTTGAAATGCTCTTGGACGTCCTCAATACGTTGCTCATGGCTGCGCGGAAGCCTTCG
GAGCGGGATCTGTATGTGGAGCTTTGCCTCACTGTGCCCGCCCGGCTCAGCCACTTGCTTCCACATCTGAGCTTC
CTCATGCGACCTCTTGTTGTTGCGCTGCGTGCAGGAACAGAGCTTGTTGGTCAGGGACTACGCACGCTCGAGCTA
TGCGTCGACAATCTGACTGCCGACTACCTGGATCCCATCATGGCGCCAGTAATTGATGAGCTCATGAGCGCGCTT
TTCAGTCACTTGAAGCCGCATCCATACAGCCATTTCCATGCTCATACCACGATGCGAATTCTGGGCAAGTTGGGC
GGTCGAAATAGGAAGTTTATGACTGCTGCTGTGCCGCTGACTTACAAGGAATACTCTGACGATGCTTCGAGCTTT
GACGTACGGCTTGTTGGCTCTAAATGGGACCGAGCTTTTCCGGCCGATCTTGGCATAGAATCGGCCATCCAGAAG
TTGATGGAGGCACCGCGAACCAACAAGAACCCTCAGAATCGCCAACATGACGACTTTTACAAGAAGCAGAGTCTT
CATCTGATCAAGTCACAGCTGAAGTTGCGCATCGGCTATGACCAGCTGCCGGACGACTTGCCCCGCATTGTGCGT
CTTCAGGCCCAAGATTTTATATCCAAGAAGCTTGACATCAATTTCTTGCCTTTTGAAACATCGAATCGTGACAAG
TCGATTGCCAAGAAGGACGAGCAGGATCAAGTGACCAAGAACTTACTCAAGGCCATCATGTTTGCCGAGTCAATA
CCAGACCTCGGCGAGGAAGATGACGCATTCCTGGTCGAAATTTGCAGACATTTCACCATTATTGAGATTGGCCGA
GCCTTGGTAGATATTAAGCGCACATTCAATGCTTTCGATCCCAAGGCTGGTGAAGGCCCTCTGTTTATTGATTCA
AGGGTTCTTTGCGACGCAATAGTCGAGTCGCTTGCATCTGACCATCCTGATGTGCGAGAGGCAGCAAAAAAGGCA
ATTCGAGAAGTGCACAAGACTGCAAGCATCATCTTGGGGTCGGAACTACATGTTGGCCGTTTACCCTTGTTCACA
CATTTGAGCAATACATTCTGCCACAGCTGCTACGAGGAGGAATGGTTCACCAAATCGGGAGGCAGTCTGGGTATC
AATTTTATGCTTACAGAACTCGACTTTGGCGACGCGTGGGTAGCTTCGAAGCAGACCGAGTTCATTCGGGCTCTC
ATGTACGTCATCAAGGACATGCCACAGGATTTGCCGGAAAAGACTAGGCGACTAGCCCAAGAGACGCTCGAGGTT
CTTTTGCGTCGCATCACCAGGCACATCAAGAAGGAAGACGCCATGCCGATAGCACAGCAACCGGGCCAGCCTCCC
CCAAAACAGACGCGCCTTGCCCAAATTTGCATGCAGTTCAATAGCGAGCTTGCCCACATGAACAAGTTTGTTCGC
GAAACGTCAAAACAGTCGCTCGAGTTGATAGCAAAGGCTGCTGGCTGTGAAGTATGGGAGCTGATTGACCCTTAC
AAGGAGCGATTTCTCCAACCCATTTACTCCAAGCCGCTGCGAGCATTGCCTTTTAGCACGCAAATTGGCTACATC
AACGCCATGACGTATCATATGAGCCTCAAGCACGACAAGGTCAACCTGGACGAGAATTTGAACCGCTTACTTATG
GAGTCTTTGGCTCTGGCAGACGCCCAGGATGACTCGCTCGCCAACAAGCCGGCTGAATACAGGACCCATCAGCAC
ATTGTCAACTTGCGTGTTTCTTGCATCAAGCTTCTCAGCACTGCCATGACATTTGAAGAGTTTGCAAACAGCCCT
ACCAAGCCAAGGATCCTCCAGGTCTTTTTCAAGTGTCTGTACTCCGAGTCAAAACCGACCATAGCGGCAGCCAAC
GACGCTCTCAAGCTGGTGCTGGCGGTGGATAGGCGTTTGCCAAAGGATCTGCTGCAAGGCGGTCTACGCCCGGTT
CTGGCCAGTCTGTCTGATCCCAAACGCCTCACTGTCCATGGCCTCGAAAACCTTTCGAGACTTTTGAAACTGCTC
AATAGCTATTTCAAGGTGGAGATTGGCGTTCGATTGTTGGATCAGATTTATTCCATTGTCGAACCCGGCGCGTGG
CAGCAGATATCCTTTACCTTTTGTGAACAAAATCCTCAAATGAAAGTCATTACCGCCGTCCTCAACATTTTCCAC
CTGCTGCCTTCCCCGGCCGAATCCTTCAAGGAGCGACTCATTGAAAACTTCCTCGAGCTTGAAGATAAGCTTAGG
AGAACTATTCAGAGTCCCTTTCGCGCTCCCATATACTTGTATCTGAACAGATACCCAAAGGAAATTTGGAAGCAC
CTGGTTGGAAAGCTGCATGAGCTCAAGTTTGGGCGACTGCTTGCCCAAGTCCTCAGTCATCCAGACAGCTCTCCC
CTGCGAGAGGTGGCTGCCGAAGGTGTGGATGCATTGGTCAGCCGATGCAACGAGGTGATGAGCGAGGGCGGCGAG
AAGAAGTTTATTGCCATTGTCAACTCGATCCACATTCTTGACTCAATCAGTCAGTGGCACAATGCTTGCGGGTGG
ATGAACAAGAAGGAAACGATATCGTGGCTCAAGACGATTGGAAAGGAGCTCGAGAGCCATATTCGGAACTACACA
CTGCCTGCGGACCTCCGTTTGCCGGCATATCAAGCCGCTGAACAGTTGATGACGGTCTTGATCAAGTCTCTGGAG
AGGAACCCAACCGACTTGGATTCTCTCTTTAGTCTAATTGAGTCGATTACTGGCGGAGAGCTGCGCGCAACCCAC
GCCCTCTACCACTTTTTGTACGAGAAGATTATCAGTAACGACTCAATCGAATTCTGGAAGACGACGGTTTTGCGC
TGTCTCGACATGTATGCTGGCAAAATGGTGTCAAACAAGACGAAGCACTTTTTGCTGCATTACATTGTCAACCCA
ATTGTGGCGATGGATGTGATGCGCCACTGGAACAGCGGCGACACTAATAAAGGTCCGCGCTTCCTCGATCGCAGC
GTGATTGATGCTGTTAGCTCCAAGATTTGGAAGGTGCACCCAGACGAGATGACGGCCGAGGATGCAACGCAGCCA
GGCATTGATCACACACGATTTGAAGTTTTGCAGCTTTCGGCGATGCTGGTCAAGTACTACCACACGACCATTTCA
GACACACGCAAGGACATCATCAAGTTTGGCTGGACATTTATCCGGCTGGACGACGTGATCAACAAGCATGCTGCA
TATGTGGTTATTGGATACTTCATTGCCCACTATGATACGCCGCCCAAGATTGTCAATCAGGTTTACCTTTCGCTG
CTCAAGACGAACCAAAACGAAGGACGGGCGCTGGTGACGCAAGCTCTCGAACTCATTGCGCCAGTGCTGCCCAAG
CGGTGCAGCAGCGGGCCTGCAGACCGCAAGGGATGCAATGAGCGTGGTACCGCATATGCCCAGCCGTGGGCCATG
GCGCCTCGACGGGTGCTTTCTGACGAAGGGCACAATGTGCAGCAAATGTCGAGCATCTTCCAGTTTTTGGTGCGG
CATCCCGAGCTGTTTTACGACGTGAGGGACAATAAGAAGCTGGCACTCAATATGATGTGGCTCATTTGGACGAAG
CGCAAGTTTGAAGGAATGGACCAGGCTACTCCCACGTCGCCCCCGGCTGTGCGGCAAACAGGCTCGAGTGAGCGC
AGCGAATTCCAAATCAGCCAAATGTTTCGTCAAAAGATGATGAAGTATCTGGTTGAATTTATTGCCCAGCTCAAC
GAACGCTACCAGCTGCCGTCTGCACGACCTCGCGAACACAACCCGTCGTCGGTTCCGCAAACGCAGCCTCATTAC
TGGGGAGACCTTGATATCGACTTGTTTCCCAACGTGACTGATGTCATTCTGTGCGGCGAAAAGACTCAGACGACG
CTCAATGCTGAGCCGTCAGACAAGGAAAAGTATGACGAGAGGTTTCTGACAAACATCATCAATACTCTGCAGGTG
GTGCGCATAATCATCAACTTCAAATCGGACGATTGGATCCAGAGGAACATTGCGGCGGTGCAAAAGGTGTTGGAG
AAGAACATCAAGTATGACGACGGGCGCCTTCTCAAGTCGATTATCCAACGAGTCTTGGATGCCGTGCCAGAGGAT
GCGCCCATGGAAGACGCCGATGCAGAGGGCGAGACGGAAGCGCAAACCTCGTCATACATTTCTGGCGTCAACCTC
CTCTGGTCGCTGGGCAAGCGCAAGCCAGCCCATTACAGCGCGCTTGCCGCGCCTGCGGCTGGAGAGCTGTCTGCC
TATGATCTCGAGATTCAGATCAAGCTCATGATCAAGGAGATACAGACAGTGGCCGTCTTGGCGACGCTGGTGGAA
AAGTCGATGAACATTGAGCTTTGCACAGAAATCCTCAACATGGTTGAGGGTTGGGTCTTTCGGTCCGAGGGCTCG
TGGCCTACGCTCAAGGAAAAGACGGCATTCCTGGACCTCGTTATTCGCATATACGAGGATCCCAAGATTGCGCGG
ACAGAGCTGACGGTGCGCATGGAGCACGCCTTCTTGATTGGCATGAGGGCCAGCGACGTGGACATGCGAAACCGC
TTCATGGCGATTTTTGACCGCAGCCTGTCACGAACAGCCAGTGCGTCGCAGTTCTTGTTGGGGGCCATCATTTCG
GCGTCGCAGCTGGCGGCGGTCTACCCAAGAGACGGCAAGGACTTGCGCGAGGCGAGCAACATGGCTGACGACAAG
TTTGAGTTGCTCATGGCTGGCCACCGTCGATTTGTCGCTGAGCTGGGCGAGCACATTGACATGACGCTGGCTCAC
CGGCTGTGGCGCGGCATGGTGGCTCTGCTGACCAAGGACTACCACAACCGGCAAATGGATAAGAGACCCAATGTG
GTGCAGTCGCTGGTGGAGGGCGCCGTCAAGACGCCGGGGTGCAGGCTGCCGCCGCATGTGCTCAAGTTTTTGGCC
AAGACGTTTGACGTGTGGTACACGGCCCTGGTGCATCTCGAGGATGCGGCCGTCAACCCCCAAAAGGACTCGGCG
CCGGTGCGGGAGAGCAATCTCAACGCGCTGGTTAAGCTGTATGCGCTGTTGAAGGAGGATGACCTCTTTTACGGA
ACATGGCGGCGACGCTGCCAGTTTGTCGAGACCAACGCAGGCCTTTCCTACGAGCAAAACGGCATGTGGGACAGG
GCGCAGAAGCTGTATGAAACGGCGCAGATCAAGGCGAGAACGGGCCGCCTGCAGCAGTGGGAGATTTTGCAGGAT
CTGGCCAAGCACGAAAACTATCAAGACTTGCTGCTTGAATGCGCCTGGCGAAACATGGACATGTGGCAAGAGGCG
CAGCACCGCGAGGCTTGCTTCATGTCGCTGCTCAAGTTGCATAACCAGCAGGAGACGGCTAATGACTTTGCGCGG
GTTTGCGACGAGGCTATCCAGCTGTCCATTAGGAAGTGGCATCAGCTGCCTGAGCGGCTGACCAATGCCCATGTG
CCCATTTTGCAAAACTTTCAGCAAATGGTGGAGTTGCATGATGCCAGCGTTATTTGCCAGAGCCTTGCAAACACG
AATGCGTCGAATCTCGACTCCAAGTCGACTGAGCTCAAGATGTTACTTGCGGGCTGGCGCGAACGACTGCCCAAT
GTTTGGGACGACATTACGGCCTGGCAGGACCTTGTGACGTGGAGGCAGCACATTTTCAATCTCATCAACCAAACA
TATCTGCAGCTGCTTCCGCCCCAGAACCAGCAAAACGCGGCGGCCGGAGCAAACTCGTTTGCCTATCGTGGCTAC
CATGAAACGGCCTGGATAATCAACCGCTTCGCCCATGTGGCGCGCAAGCACAGCCTGCCTGAAGTGTGCATCAGC
CAACTGAGCCGCATCTACACGCTGCCAAACATTGAGATTCAGGAAGCCTTTTTGAAGTTGCGCGAGCAGGCCAAG
TGCCATTACGAGAGTGCCGAAGAACTGTCGAATGGCCTCGACGTCATCAACAATACCAATCTCAGCTACTTCAAC
CAGCAGCAAAAGGCTGAATTCTTCACTCTCAAGGGCATGTTCCTCGAAAAGCTGGGCCAAAAGAGCGAGGCTGAC
AGCTCCTTTGGCACTGCTCTCTACTACGACATTGGCGCCGCCAAGGCGTGGGCTGAATGGGGCTACTTCAACGAC
AGGAAATTCAAGGAGGACCCGACTGACCTCAATGCCGCTCGCCAGGCCTTGACGTCGTATCTGCAGGCGGCTGGC
AGCTACAAGAACGGCAAGTCGCGCAAGCTGCTGGCCCGGATTCTCTGGCTCCTCAGCATTGATGATGACAAGGGC
ACCATTGCCATGGGCTTTGACGACTACAAGGGAGAGACGCCGGTGTGGTACTGGATCACCTTTATCCCCCAGCTG
CTGACGGGACTTGGCCACAAGGAGGCGCCGCGCGTCTTCAACATTTTGCTCAATATTGCCAAGTCGTACCCACAG
GCGCTCTACTTCCAGCTGCGCACGAGCCGCGAGGACATGCACATCATCAAGAAGAACCAAGAGGCCAAGGAGCGA
GCACGCCAGCAACAGGCACAGCAAAACCGCCCAGACGGCTCCAGAGCTGCCTCGCGCCCCGGCACGGCCAATGGA
ACGGCCAGCGGGGCCGAGGCTACGCCCGCGAGGAGCGACGGAGGCGACGCGGGGCCGCAGTCGTCACGCGCGGGC
TCTCAGGCTCAAGAGCAGCAGCCACAGGGCCCCGGCCACAAGAAGCATCCCTGGGAGCTGACAGACGAGGTCATG
TCGGTCCTCAAGACGGCCTTCCCTCTCTTGGCGCTGTCCATGGAGACCATGGTGGATCAAATCCAGAAAAACTTC
AAGTGTCCGCCCGACGAGGACGCCTACCGACTCATTGTTGCCTTGCTTAATGATGCGCTGACATATGTGAGTCGC
ACGCCGGCTTCGTTTGCCAAGAGCGTCAAGCTGCCGTCGGCAACCGAGACCAACATTACCCGGTTTGCCGAGAAT
ATTCTGCCCAGCCATATAAAGAAGTCGTTTGAGGCCGACTTTGTCAAGGTGAAGCCCACCATGTATGAGTATATA
CACAAGCTGCGACGATGGCGAAGCAAATTCGAAGAGAAGCTGGATCGGCGGGTGAGGCATGCGCCCCTCGAGAGC
TTCTCGCCGCATCTAAGCGAGTTTCGCTACCAAAAGTTTGACGAGGTTGAGGTGCCGGGACAGTATCTTCAACAC
AAGGACAGAAACCAAGACTTTATTCGCATCGAGCGATTTCTGCCCAATGTGGACCTGGTGCGGTCGTATAGCGCC
TCATACCGACGGCTCAAGATGCGTGGCCACGACGGCAGTGTGCATGCGTGGGCGGTGCAGCATCCGGCAGCTCGG
CACTGTCGAAGGGAAGAGCGTGTAGCGCAGCTGTTTCGGCAGCTCAACCAGACGCTGAGCCGCAAGAAGGAAAGC
CGGCGACGCGATTTACAATTTACGCTGCCCCTCATGGTGCCGCTGGCGCCCCATATACGCATAGTGCAAGAGGAT
ACTTCGTATGTGACGCTGCAGGCTGTCTACGAGGACCACTGCAGGCTGGTTGGTCTTCGCAAGGACGAGCCTGTC
CTCTTCACCCTCGACAAGCTTCGGGGCGTGCTGGAAAGCAAAAACCAGCTGGGCAAGGCAGAGCTGGCTCCAGCG
GCACGGCTCGAGGTGATGAAGGCGGTGCAGGCCAAGTGGGTGCCTGGAACGGTTGCGCTCGAGTACTTCCAGCAA
GTCTTTCCGCAGTTTGCCGAGTTTTGGCTCTTTCGCCGGCAGTTTTCATATCAGCTGGCGGCTCTGTCCTTCATG
ACGTATATTGTCTTTATGCAGAACCGGAACCCCTTCAAGATGAGCATCTCGCGAGCGTCGGGCAATATCTGGGGC
TCGGAGCTCATCAGCTTCATGAGCGTCACCAAGCCCCTCTTTGTGAGCGTGGAGCCGGTGCCCTTTCGCCTGACG
CCCAGTCTGCAGGTGCTCATGGGACCCTTGGCAACCGAAGGCATTTTTGGCTGCTCGCTCATGGCCATTGCGCGG
TGCCTGACGGAGCCACAGCAGGAGCTGGAGCACGCCTTGACGCTGTTTGTTCGCGACGAAGTCATTTGTTGGATG
ACGAGTAGCCACCGCAACGCCATTAGCGAGAACCAGCTGCGCGAGTCTGTCCAGGTCAATAGCGACTCGATTTTG
AAACGGGCGCTTAGTTTGGCGCACAATCCATCGGGAAACCTACCGGCCAACCAGACGGTGATTGACGCCATTTCC
AAGGCGGTCAACCCCATGAACCTGGCCCAATGCGATGCGCTCTGGATGCCTTATTTATAG
Gene >OphauB2|1373
ATGTCGGGGACCTCTCTCGACGACGTCGTCAAGCGTCTTAGCACGTCCGACCTTGGTGCGTTGCTTATGTTAATT
CCACGTTTGCTCAGGCCTCGTTATTGGGCTAATAGTCTCAAAAACAGAGGCGAAAGATCGGTTGGAGGCCGCCAC
ATCTCTGCGCGACAGTCTAGATCACTATACTAGCGGCCAGTTATATACAGTTGTCCTTAAACGCTTGATGCCAGT
ATTTATCAACATCTTGCGCGGACCATGCATTTATCAAAGCAACTCCCCAGAACAGGTTGGCACTCTTGTTCTCCT
TGGCTTTGCTTTGGCGCCTTTCTTACTTAATTGTGCTTTTTTTTTCTTAGAAACTTCGTCACTGTATTCTCGAAA
TCCTCCACCGACTACCAACTGCGCCTGCACCTACAGAACCATTTGAACCTTATGCTCAAGAGACATGTGAGCTGC
TCATGCAGCTTGTACGGAACGACAACGAAGACAATGCGACTCTCTGCGTCAAGATTACGTCGGACATTATGCGCC
ATCAACACAAGGCTCTTCAGGCCAAGGTCCAAGACTTTCTCTCTCTTATTCAAGAGCTTTTCGAACAGATGCCCA
AAGTGGTAAGGGAGCAGCTTGACAATGCTCCCTCGGCGACGTTGGGACAATCTGGCGCGCCATCAACCCCCGGAA
GTCAGCAGACCAACTTCCAGTCGCCTCGGCCTGCTTCGCCTGTTGTTTCCGTTCCGGATCTAGCGGCGGATGCCC
AACAGCAAAACCGCCCCCTCTTGAGAGGAATGCAGTCTTTCAAAGTTTTGTCGGAATGTCCCATCATCGTTGTCT
CCATTTTCCAAATCTACCGAGCAACAGTGCCCCAGAACGTCAAGGCTTTTGTTCCACTCATCAAAAACGTCCTCT
TGCTGCAGGCCAACGCTCAGAAGCAAGCTCACGCGGATGCAGCCGCCAGAGGTCAGACACATACTGGCGTAAGTT
CTGGGATCAAGAATCGTGCGGCTTTTGGCGAATTCATCACGGCTCAGGTTAAGACTATGAGCTTTTTGGCCTATA
TCATGCGACAGTATTCATCACATCTTAACGATTTTCTGCCGGCGCTACCAAACGTCATTGTCCGCCTCCTCAGAG
ACTGTCCTCGCGACAAATCTGCTGCTCGAAAAGAGCTACTCATTGCCATACGCCACATTATAAATTACAATTTTC
GCAAACTCTTCGTACCCATTATTGATGACCTGCTGGACGAGCGAACCTTGACTGGAGATGGCTTAACAGTTTATG
AAACCATGAGGCCTTTGGCTTTCAGCATGTTGGCCGATTTAATCCATCACGTACGAGACTCGCTGGGCCCAGACC
AGATCCGCAAGACTGTTGAAGTCTACACCAAAAATCTCCAGGACAGCTTTCCGGGAACTAGCTTTCAAACAATGA
GTGCCAAGCTACTTCTCAACATGGCGGAGTGTATTGCAAAGCTACCAAACAAAGTCGACGCTAGGCATTACCACA
TGCTTATCCTCAATGCAATAGGGGATAAGTTTGCAGCCATGAATCGGCAGTATCCGAATGCCGTCAAACTTTCCA
AGCAGTACCACCAACAGGCAGAGACGGGCATCTCTGAGACGTATTTGGCCGACAAGGAACATCCCCCAGACTGGG
ATGAGACGGATATATTTTCTGCCGTGCCCATCAAGATTTCCAACCCTCGCGATAGGGGCGCCGACCCAGTGGTGG
ATAATAAGTTTCTGTTTCGGAATCTTATGAATGGCCTGAAGAATACTTTTTACCAACTACGCGCCTGCAACGTTG
CCCCTCCAATCGATCCGCAGTTTGCTCCCTCGCATTGGCAGGACGTGTCCTATGGCTTCACGGCTGAAGAAGTCA
ACATAATCATCAAATTGTTTCGGGAGGGTGCTCACGTTTTCAGATACTACGAGATTGAGAAGCCAGTGTCGGAAT
CCCAATACTCGTCTCCAGTTGAACAAATGGCAAATTTCTACATGATTTCTAGCAGCAAAGAGGAGAAGGATTTAC
TCGAGACGTTCGCTACTGTCTTCCACTGCATTGACCCAGCAACTTTTCACGAAGTTTTCCAGCAAGAGATACCAA
AACTGTATGAAATGATCTTCGAGCATACAGCGCTGTTGCACATTCCGCAATTCTTCCTTGCCAGCGAAGCGACTT
CACCCAGCTTCTGTGGCATGCTTCTTCAATTTCTCATGGAGCATATCGACGAAGTTGGCTCTGCAGATGTGAGGA
AGTCATCGATTCTACTGAGGCTCTTCAAGCTTGCTTTCATGGCGGTCACACTCTTTGCAGCACAAAACGAGCAAG
TCCTTCTCCCACATGTGGTTAACATTGTCACAAAATCTATTGAATTGTCAACAAAGGCTGAGGAGCCTATTAATT
ACTTTCTCCTTCTCCGTTCGCTCTTTCGAAGCATTGGGGGAGGCAAATTCGAACAGCTTTACAAGCAAATTTTGC
CATTGCTTGAAATGCTCTTGGACGTCCTCAATACGTTGCTCATGGCTGCGCGGAAGCCTTCGGAGCGGGATCTGT
ATGTGGAGCTTTGCCTCACTGTGCCCGCCCGGCTCAGCCACTTGCTTCCACATCTGAGCTTCCTCATGCGACCTC
TTGTTGTTGCGCTGCGTGCAGGAACAGAGCTTGTTGGTCAGGGACTACGCACGCTCGAGCTATGCGTCGACAATC
TGACTGCCGACTACCTGGATCCCATCATGGCGCCAGTAATTGATGAGCTCATGAGCGCGCTTTTCAGTCACTTGA
AGCCGCATCCATACAGCCATTTCCATGCTCATACCACGATGCGAATTCTGGGCAAGTTGGGCGGTCGAAATAGGA
AGTTTATGACTGCTGCTGTGCCGCTGACTTACAAGGAATACTCTGACGATGCTTCGAGCTTTGACGTACGGCTTG
TTGGCTCTAAATGGGACCGAGCTTTTCCGGCCGATCTTGGCATAGAATCGGCCATCCAGAAGTTGATGGAGGCAC
CGCGAACCAACAAGAACCCTCAGAATCGCCAACATGACGACTTTTACAAGAAGCAGAGTCTTCATCTGATCAAGT
CACAGCTGAAGTTGCGCATCGGCTATGACCAGCTGCCGGACGACTTGCCCCGCATTGTGCGTCTTCAGGCCCAAG
ATTTTATATCCAAGAAGCTTGACATCAATTTCTTGCCTTTTGAAACATCGAATCGTGACAAGTCGATTGCCAAGA
AGGACGAGCAGGATCAAGTGACCAAGAACTTACTCAAGGCCATCATGTTTGCCGAGTCAATACCAGACCTCGGCG
AGGAAGATGACGCATTCCTGGTCGAAATTTGCAGACATTTCACCATTATTGAGATTGGCCGAGCCTTGGTAGATA
TTAAGCGCACATTCAATGCTTTCGATCCCAAGGCTGGTGAAGGCCCTCTGTTTATTGATTCAAGGGTTCTTTGCG
ACGCAATAGTCGAGTCGCTTGCATCTGACCATCCTGATGTGCGAGAGGCAGCAAAAAAGGCAATTCGAGAAGTGC
ACAAGACTGCAAGCATCATCTTGGGGTCGGAACTACATGTTGGCCGTTTACCCTTGTTCACACATTTGAGCAATA
CATTCTGCCACAGCTGCTACGAGGAGGAATGGTTCACCAAATCGGGAGGCAGTCTGGGTATCAATTTTATGCTTA
CAGAACTCGACTTTGGCGACGCGTGGGTAGCTTCGAAGCAGACCGAGTTCATTCGGGCTCTCATGTACGTCATCA
AGGACATGCCACAGGATTTGCCGGAAAAGACTAGGCGACTAGCCCAAGAGACGCTCGAGGTTCTTTTGCGTCGCA
TCACCAGGCACATCAAGAAGGAAGACGCCATGCCGATAGCACAGCAACCGGGCCAGCCTCCCCCAAAACAGACGC
GCCTTGCCCAAATTTGCATGCAGTTCAATAGCGAGCTTGCCCACATGAACAAGTTTGTTCGCGAAACGTCAAAAC
AGTCGCTCGAGTTGATAGCAAAGGCTGCTGGCTGTGAAGTATGGGAGCTGATTGACCCTTACAAGGAGCGATTTC
TCCAACCCATTTACTCCAAGCCGCTGCGAGCATTGCCTTTTAGCACGCAAATTGGCTACATCAACGCCATGACGT
ATCATATGAGCCTCAAGCACGACAAGGTCAACCTGGACGAGAATTTGAACCGCTTACTTATGGAGTCTTTGGCTC
TGGCAGACGCCCAGGATGACTCGCTCGCCAACAAGCCGGCTGAATACAGGACCCATCAGCACATTGTCAACTTGC
GTGTTTCTTGCATCAAGCTTCTCAGCACTGCCATGACATTTGAAGAGTTTGCAAACAGCCCTACCAAGCCAAGGA
TCCTCCAGGTCTTTTTCAAGTGTCTGTACTCCGAGTCAAAACCGACCATAGCGGCAGCCAACGACGCTCTCAAGC
TGGTGCTGGCGGTGGATAGGCGTTTGCCAAAGGATCTGCTGCAAGGCGGTCTACGCCCGGTTCTGGCCAGTCTGT
CTGATCCCAAACGCCTCACTGTCCATGGCCTCGAAAACCTTTCGAGACTTTTGAAACTGCTCAATAGCTATTTCA
AGGTGGAGATTGGCGTTCGATTGTTGGATCAGATTTATTCCATTGTCGAACCCGGCGCGTGGCAGCAGATATCCT
TTACCTTTTGTGAACAAAATCCTCAAATGAAAGTCATTACCGCCGTCCTCAACATTTTCCACCTGCTGCCTTCCC
CGGCCGAATCCTTCAAGGAGCGACTCATTGAAAACTTCCTCGAGCTTGAAGATAAGCTTAGGAGAACTATTCAGA
GTCCCTTTCGCGCTCCCATATACTTGTATCTGAACAGATACCCAAAGGAAATTTGGAAGCACCTGGTTGGAAAGC
TGCATGAGCTCAAGTTTGGGCGACTGCTTGCCCAAGTCCTCAGTCATCCAGACAGCTCTCCCCTGCGAGAGGTGG
CTGCCGAAGGTGTGGATGCATTGGTCAGCCGATGCAACGAGGTGATGAGCGAGGGCGGCGAGAAGAAGTTTATTG
CCATTGTCAACTCGATCCACATTCTTGACTCAATCAGTCAGTGGCACAATGCTTGCGGGTGGATGAACAAGAAGG
AAACGATATCGTGGCTCAAGACGATTGGAAAGGAGCTCGAGAGCCATATTCGGAACTACACACTGCCTGCGGACC
TCCGTTTGCCGGCATATCAAGCCGCTGAACAGTTGATGACGGTCTTGATCAAGTCTCTGGAGAGGAACCCAACCG
ACTTGGATTCTCTCTTTAGTCTAATTGAGTCGATTACTGGCGGAGAGCTGCGCGCAACCCACGCCCTCTACCACT
TTTTGTACGAGAAGATTATCAGTAACGACTCAATCGAATTCTGGAAGACGACGGTTTTGCGCTGTCTCGACATGT
ATGCTGGCAAAATGGTGTCAAACAAGACGAAGCACTTTTTGCTGCATTACATTGTCAACCCAATTGTGGCGATGG
ATGTGATGCGCCACTGGAACAGCGGCGACACTAATAAAGGTCCGCGCTTCCTCGATCGCAGCGTGATTGATGCTG
TTAGCTCCAAGATTTGGAAGGTGCACCCAGACGAGATGACGGCCGAGGATGCAACGCAGCCAGGCATTGATCACA
CACGATTTGAAGTTTTGCAGCTTTCGGCGATGCTGGTCAAGTACTACCACACGACCATTTCAGACACACGCAAGG
ACATCATCAAGTTTGGCTGGACATTTATCCGGCTGGACGACGTGATCAACAAGCATGCTGCATATGTGGTTATTG
GATACTTCATTGCCCACTATGATACGCCGCCCAAGATTGTCAATCAGGTTTACCTTTCGCTGCTCAAGACGAACC
AAAACGAAGGACGGGCGCTGGTGACGCAAGCTCTCGAACTCATTGCGCCAGTGCTGCCCAAGCGGTGCAGCAGCG
GGCCTGCAGACCGCAAGGGATGCAATGAGCGTGGTACCGCATATGCCCAGCCGTGGGCCATGGCGCCTCGACGGG
TGCTTTCTGACGAAGGGCACAATGTGCAGCAAATGTCGAGCATCTTCCAGTTTTTGGTGCGGCATCCCGAGCTGT
TTTACGACGTGAGGGACAAGTACGTTGTGCTACTCATCAGTTCGCTGAGAAAGGTTGCTGCGCCGCCAAACACGT
CGCACGACAGTAAGAAGCTGGCACTCAATATGATGTGGCTCATTTGGACGTGGGAGCAGTGGCGTGTTGAGGGCA
AGCCATCGGCCACGCCAGCGGCCCGAGAAGTGTCTGGCTCGCCAACAAGCAGGAAGCGCAAGTTTGAAGGAATGG
ACCAGGCTACTCCCACGTCGCCCCCGGCTGTGCGGCAAACAGGCTCGAGTGAGCGCAGCGAATTCCAAATCAGCC
AAATGTTTCGTCAAAAGATGATGAAGTATCTGGTTGAATTTATTGCCCAGCTCAACGAACGCTACCAGCTGCCGT
CTGCACGACCTCGCGAACACAACCCGTCGTCGGTTCCGCAAACGCAGCCTCATGTTGAGCTTTGCAAAAAGGCAT
TCACTCTGCTCTATAACCTGGTGCAACCGCAGTACTGGGGAGACCTTGATATCGACTTGTTTCCCAACGTGACTG
ATGTCATTCTGTGCGGCGAAAAGACTCAGACGACGCTCAATGCTGAGCCGTCAGACAAGGAAAAGTATGACGAGA
GGTTTCTGACAAACATCATCAATACTCTGCAGGTGGTGCGCATAATCATCAACTTCAAATCGGACGATTGGATCC
AGAGGAACATTGCGGCGGTGCAAAAGGTGTTGGAGAAGAGTCTCAAGTGCGAAAACCCCGAGATACAGGACTGCT
TGCATCTGGCAGACATCAAGTATGACGACGGGCGCCTTCTCAAGTCGATTATCCAACGAGTCTTGGATGCCGTGC
CAGAGGATGCGCCCATGGAAGACGCCGATGCAGAGGGCGAGACGGAAGCGCAAACGTCTGAAATTATTGCGCACC
TCTCGCAGGCCGCTACCGAGGCCATGAATAGCTCGTCATACATTTCTGGCGTCAACCTCCTCTGGTCGCTGGGCA
AGCGCAAGCCAGCCGTCATTGATGGCCACATTCCATCCTTGATGAAGGCGCTGCAGAGCAAGCATGCGCGGGACC
ATTTGCAGCATTACAGCGCGCTTGCGTCGCAGGCGGCCAACGCTAACAGTCGCTTGCAGCCAGACAGCGCGCCTG
CGGCTGGAGAGCTGTCTGCCTATGATCTCGAGATTCAGATCAAGCTCATGATCAAGGAGATACAGACAGTGGCGT
TGCGCATGGAGAGCTTGGGAGAAACGCGGCGGCCCTTTCTCAGCGTCTTGGCGACGCTGGTGGAAAAGTCGATGA
ACATTGAGCTTTGCACAGAAATCCTCAACATGGTTGAGGGTTGGGTCTTTCGGTCCGAGGGCTCGTGGCCTACGC
TCAAGGAAAAGACGGCAGTGTTGCACAAGATGCTGTCGTTTGAACACCGACAGGATCCAACAATGCTGTCCAAGT
TCCTGGACCTCGTTATTCGCATATACGAGGATCCCAAGATTGCGCGGACAGAGCTGACGGTGCGCATGGAGCACG
CCTTCTTGATTGGCATGAGGGCCAGCGACGTGGACATGCGAAACCGCTTCATGGCGATTTTTGACCGCAGCCTGT
CACGAACAGCCAGTGTGCGCCTATCGTATGTCTTGACGGAGCAGAATTGGGACACGTTGGCCGACTCGTACTGGC
TTGCGCAGGCGTCGCAGTTCTTGTTGGGGGCCGTGGAGCTGAATTGCAACGTGCAGCTAAATGCCGACGACTTCA
AGATCATTTCGGCGTCGCAGCTGGCGGCGGTCTACCCAAGAGACGGCAAGGACTTGCGCGAGGCGAGCAACATGG
CTGACGACAAGTTTGAGTTGCTCATGGCTGGCCACCGTCGATTTGTCGCTGAGCTGGGCGAGGTCAAGGTGCGGG
ACATTTTGGAGCCGCTCTGGCAGCTGCAGCACATTGACATGACGCTGGCTCACCGGCTGTGGGTGACGCTCTTCC
CCATGTACTGGTCGGCAGTTGTTCGAGACGAGCGCATGGAGCTGCAGCGCGGCATGGTGGCTCTGCTGACCAAGG
ACTACCACAACCGGCAAATGGATAAGAGACCCAATGTGGTGCAGTCGCTGGTGGAGGGCGCCGTCAAGACGCCGG
GGTGCAGGCTGCCGCCGCATGTGCTCAAGTTTTTGGCCAAGACGTTTGACGTGTGGTACACGGCCCTGGTGCATC
TCGAGGATGCGGCCGTCAACCCCCAAAAGGACTCGGCGCCGGTGCGGGAGAGCAATCTCAACGCGCTGGTTAAGC
TGTATGCGCTGTTGAAGGAGGATGACCTCTTTTACGGAACATGGCGGCGACGCTGCCAGTTTGTCGAGACCAACG
CAGGCCTTTCCTACGAGCAAAACGGCATGTGGGACAGGGCGCAGAAGCTGTATGAAACGGCGCAGATCAAGGCGA
GAACGGGCGTGATTCCCTTTTGCCAGTCCGAGTACGTGATTTGGGAGGACCACTGGGTTTTGTGTGCGCAGCGCC
TGCAGCAGTGGGAGATTTTGCAGGATCTGGCCAAGCACGAAAACTATCAAGACTTGCTGCTTGAATGCGCCTGGC
GAAACATGGACATGTGGCAAGAGGCGCAGCACCGCGAGGCTGTTGACAATGTCATCAAGGGTGTCATGGATGCGC
CGACGCCGCGCCGCTACTTCTTCCAGTGCTTCATGTCGCTGCTCAAGTTGCATAACCAGCAGGAGACGGCTAATG
ACTTTGCGCGGGTTTGCGACGAGGCTATCCAGCTGTCCATTAGGAAGTGGCATCAGCTGCCTGAGCGGCTGACCA
ATGCCCATGTGCCCATTTTGCAAAACTTTCAGCAAATGGTGGAGTTGCATGATGCCAGCGTTATTTGCCAGAGCC
TTGCAAACACGAATGCGTCGAATCTCGACTCCAAGTCGACTGAGCTCAAGATGTTACTTGCGGGCTGGCGCGAAC
GACTGCCCAATGTTTGGGACGACATTACGGCCTGGCAGGACCTTGTGACGTGGAGGCAGCACATTTTCAATCTCA
TCAACCAAACATATCTGCAGCTGCTTCCGCCCCAGAACCAGCAAAACGCGGCGGCCGGAGCAAACTCGTTTGCCT
ATCGTGGCTACCATGAAACGGCCTGGATAATCAACCGCTTCGCCCATGTGGCGCGCAAGCACAGCCTGCCTGAAG
TGTGCATCAGCCAACTGAGCCGCATCTACACGCTGCCAAACATTGAGATTCAGGAAGCCTTTTTGAAGTTGCGCG
AGCAGGCCAAGTGCCATTACGAGAGTGCCGAAGAACTGTCGAATGGCCTCGACGTCATCAACAATACCAATCTCA
GCTACTTCAACCAGCAGCAAAAGGCTGAATTCTTCACTCTCAAGGGCATGTTCCTCGAAAAGCTGGGCCAAAAGA
GCGAGGCTGACAGCTCCTTTGGCACTGCTCTCTACTACGACATTGGCGCCGCCAAGGCGTGGGCTGAATGGGGCT
ACTTCAACGACAGGAAATTCAAGGAGGACCCGACTGACCTCAATGCCGCTCGCCAGGCCTTGACGTCGTATCTGC
AGGCGGCTGGCAGCTACAAGAACGGCAAGTCGCGCAAGCTGCTGGCCCGGATTCTCTGGCTCCTCAGCATTGATG
ATGACAAGGGCACCATTGCCATGGGCTTTGACGACTACAAGGGAGAGACGCCGGTGTGGTACTGGATCACCTTTA
TCCCCCAGCTGCTGACGGGACTTGGCCACAAGGAGGCGCCGCGCGTCTTCAACATTTTGCTCAATATTGCCAAGT
CGTACCCACAGGCGCTCTACTTCCAGCTGCGCACGAGCCGCGAGGACATGCACATCATCAAGAAGAACCAAGAGG
CCAAGGAGCGAGCACGCCAGCAACAGGCACAGCAAAACCGCCCAGACGGCTCCAGAGCTGCCTCGCGCCCCGGCA
CGGCCAATGGAACGGCCAGCGGGGCCGAGGCTACGCCCGCGAGGAGCGACGGAGGCGACGCGGGGCCGCAGTCGT
CACGCGCGGGCTCTCAGGCTCAAGAGCAGCAGCCACAGGGCCCCGGCCACAAGAAGCATCCCTGGGAGCTGACAG
ACGAGGTCATGTCGGTCCTCAAGACGGCCTTCCCTCTCTTGGCGCTGTCCATGGAGACCATGGTGGATCAAATCC
AGAAAAACTTCAAGTGTCCGCCCGACGAGGACGCCTACCGACTCATTGTTGCCTTGCTTAATGATGCGCTGACAT
ATGTGAGTCGCACGCCGGCTTCGTTTGCCAAGAGCGTCAAGCTGCCGTCGGCAACCGAGACCAACATTACCCGGT
TTGCCGAGAATATTCTGCCCAGCCATATAAAGAAGTCGTTTGAGGCCGACTTTGTCAAGGTGAAGCCCACCATGT
ATGAGTATATACACAAGCTGCGACGATGGCGAAGCAAATTCGAAGAGAAGCTGGATCGGCGGGTGAGGCATGCGC
CCCTCGAGAGCTTCTCGCCGCATCTAAGCGAGTTTCGCTACCAAAAGTTTGACGAGGTTGAGGTGCCGGGACAGT
ATCTTCAACACAAGGACAGAAACCAAGACTTTATTCGCATCGAGCGATTTCTGCCCAATGTGGACCTGGTGCGGT
CGTATAGCGCCTCATACCGACGGCTCAAGATGCGTGGCCACGACGGCAGTGTGCATGCGTGGGCGGTGCAGCATC
CGGCAGCTCGGCACTGTCGAAGGGAAGAGCGTGTAGCGCAGCTGTTTCGGCAGCTCAACCAGACGCTGAGCCGCA
AGAAGGAAAGCCGGCGACGCGATTTACAATTTACGCTGCCCCTCATGGTGCCGCTGGCGCCCCATATACGCATAG
TGCAAGAGGATACTTCGTATGTGACGCTGCAGGCTGTCTACGAGGACCACTGCAGGCTGGTTGGTCTTCGCAAGG
ACGAGCCTGTCCTCTTCACCCTCGACAAGCTTCGGGGCGTGCTGGAAAGCAAAAACCAGGTAAGCAGCAGCATGG
GCTGGCCAGCCAAGGACATCAAGGCTGACAGGCGCCAACAGCTGGGCAAGGCAGAGCTGGCTCCAGCGGCACGGC
TCGAGGTGATGAAGGCGGTGCAGGCCAAGTGGGTGCCTGGAACGGTTGCGCTCGAGTACTTCCAGCAAGTCTTTC
CGCAGTTTGCCGAGTTTTGGCTCTTTCGCCGGCAGTTTTCATATCAGCTGGCGGCTCTGTCCTTCATGACGTATA
TTGTCTTTATGCAGAACCGGAACCCCTTCAAGATGAGCATCTCGCGAGCGTCGGGCAATATCTGGGGCTCGGAGC
TCATCAGCTTCATGAGCGTCACCAAGCCCCTCTTTGTGAGCGTGGAGCCGGTGCCCTTTCGCCTGACGCCCAGTC
TGCAGGTGCTCATGGGACCCTTGGCAACCGAAGGCATTTTTGGCTGCTCGCTCATGGCCATTGCGCGGTGCCTGA
CGGAGCCACAGCAGGAGCTGGAGCACGCCTTGACGCTGTTTGTTCGCGACGAAGTCATTTGTTGGATGACGAGTA
GCCACCGCAACGCCATTAGCGAGAACCAGCTGCGCGAGTCTGTCCAGGTCAATAGCGACTCGATTTTGAAACGGG
CGCTTAGTTTGGCGCACAATCCATCGGGAAACCTACCGGCCAACCAGACGGTGATTGACGCCATTTCCAAGGCGG
TCAACCCCATGAACCTGGCCCAATGCGATGCGCTCTGGATGCCTTATTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail