Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|137
Gene name
LocationContig_1:347099..347771
Strand+
Gene length (bp)672
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 9.0E-10 3 81
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 1.8E-08 12 82
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 5.4E-08 6 87
PF00043 GST_C Glutathione S-transferase, C-terminal domain 7.3E-06 144 194
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 7.1E-05 133 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43123|MAAI_EMENI Maleylacetoacetate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=maiA PE=1 SV=1 5 221 4.0E-70
sp|D2YW48|GST_COCIM Probable glutathione S-transferase OS=Coccidioides immitis (strain RS) GN=CIMG_01314 PE=1 SV=2 3 221 1.0E-67
sp|O43708|MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens GN=GSTZ1 PE=1 SV=3 6 221 1.0E-49
sp|Q9WVL0|MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus GN=Gstz1 PE=1 SV=1 6 221 2.0E-49
sp|P57113|MAAI_RAT Maleylacetoacetate isomerase OS=Rattus norvegicus GN=Gstz1 PE=1 SV=2 6 221 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43123|MAAI_EMENI Maleylacetoacetate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=maiA PE=1 SV=1 5 221 4.0E-70
sp|D2YW48|GST_COCIM Probable glutathione S-transferase OS=Coccidioides immitis (strain RS) GN=CIMG_01314 PE=1 SV=2 3 221 1.0E-67
sp|O43708|MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens GN=GSTZ1 PE=1 SV=3 6 221 1.0E-49
sp|Q9WVL0|MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus GN=Gstz1 PE=1 SV=1 6 221 2.0E-49
sp|P57113|MAAI_RAT Maleylacetoacetate isomerase OS=Rattus norvegicus GN=Gstz1 PE=1 SV=2 6 221 2.0E-49
sp|Q9VHD2|MAAI2_DROME Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster GN=GstZ2 PE=1 SV=1 6 220 2.0E-44
sp|P57109|MAAI_PSEAE Maleylacetoacetate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=maiA PE=3 SV=1 5 217 7.0E-38
sp|Q54YN2|MAAI_DICDI Maleylacetoacetate isomerase OS=Dictyostelium discoideum GN=mai PE=3 SV=1 6 215 3.0E-37
sp|Q9KSB2|MAAI_VIBCH Probable maleylacetoacetate isomerase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=maiA PE=3 SV=1 1 216 6.0E-36
sp|Q9VHD3|MAAI1_DROME Probable maleylacetoacetate isomerase 1 OS=Drosophila melanogaster GN=GstZ1 PE=1 SV=1 2 223 2.0E-35
sp|Q9X4F7|MAAI_RHIME Maleylacetoacetate isomerase OS=Rhizobium meliloti (strain 1021) GN=maiA PE=3 SV=1 6 209 9.0E-35
sp|O86043|NAGL_RALSP Maleylpyruvate isomerase OS=Ralstonia sp. GN=nagL PE=1 SV=1 5 216 1.0E-34
sp|Q9ZVQ4|GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana GN=GSTZ2 PE=3 SV=1 5 217 5.0E-34
sp|Q18938|MAAI_CAEEL Probable maleylacetoacetate isomerase OS=Caenorhabditis elegans GN=gst-42 PE=1 SV=1 6 218 3.0E-33
sp|P57108|GSTZ_EUPES Glutathione S-transferase zeta class OS=Euphorbia esula PE=2 SV=1 5 216 1.0E-32
sp|Q9ZVQ3|GSTZ1_ARATH Glutathione S-transferase Z1 OS=Arabidopsis thaliana GN=GSTZ1 PE=1 SV=1 5 217 3.0E-31
sp|P28342|GSTZ1_DIACA Glutathione S-transferase 1 OS=Dianthus caryophyllus GN=GST1 PE=2 SV=1 6 192 3.0E-31
sp|Q03425|GSTZ2_DIACA Glutathione S-transferase 2 (Fragment) OS=Dianthus caryophyllus GN=GST2 PE=2 SV=1 6 144 1.0E-18
sp|O04437|GSTZ_WHEAT Glutathione S-transferase OS=Triticum aestivum GN=GSTZ1 PE=1 SV=1 6 217 4.0E-16
sp|Q9CNB0|SSPA_PASMU Stringent starvation protein A homolog OS=Pasteurella multocida (strain Pm70) GN=sspA PE=3 SV=1 17 185 3.0E-09
sp|P31784|SSPA_HISSO Stringent starvation protein A homolog OS=Histophilus somni GN=sspA PE=3 SV=1 17 183 4.0E-09
sp|Q83AY0|SSPA_COXBU Stringent starvation protein A homolog OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sspA PE=1 SV=1 5 183 2.0E-08
sp|P0ACA6|SSPA_SHIFL Stringent starvation protein A OS=Shigella flexneri GN=sspA PE=3 SV=2 5 185 4.0E-08
sp|P0ACA3|SSPA_ECOLI Stringent starvation protein A OS=Escherichia coli (strain K12) GN=sspA PE=1 SV=2 5 185 4.0E-08
sp|P0ACA4|SSPA_ECOL6 Stringent starvation protein A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sspA PE=3 SV=2 5 185 4.0E-08
sp|P0ACA5|SSPA_ECO57 Stringent starvation protein A OS=Escherichia coli O157:H7 GN=sspA PE=3 SV=2 5 185 4.0E-08
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 1 199 3.0E-07
sp|Q9SRY6|GSTF5_ARATH Glutathione S-transferase F5 OS=Arabidopsis thaliana GN=GSTF5 PE=3 SV=2 3 83 4.0E-07
sp|Q9LZI9|GSTFD_ARATH Glutathione S-transferase F13 OS=Arabidopsis thaliana GN=GSTF13 PE=3 SV=1 5 176 7.0E-07
sp|P46423|GSTF_HYOMU Glutathione S-transferase OS=Hyoscyamus muticus PE=1 SV=1 12 175 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|137
MTQYSLYSYFRSSCSARLRIMLHLKKIAFDTVPVNILKNEHSSSSHMALNPSGSVPLLLSHRSEDQGLAIGQSVA
AMEYLDDVFPLPPTLPPAGDAAGRAVVRALVNIICCDVQPVTNRKIMRRVTELGGNAEEWNRELMTAGLRAYEQT
ARDHAGVYSFGDEITMADICLVPAVWNAERYGIDLEAEFPLIFAIAQKLSGHDAVIQAHWARQPDTPLELRQE*
Coding >OphauB2|137
ATGACGCAATACTCGCTATACAGCTACTTTCGCTCCTCGTGCTCCGCGCGCCTGCGCATCATGCTGCACCTCAAA
AAGATTGCCTTTGACACGGTTCCCGTCAACATTCTCAAGAATGAGCACTCGTCAAGCTCCCACATGGCCCTCAAT
CCTTCTGGGTCCGTCCCGCTCCTCCTCTCCCACCGCAGCGAGGACCAGGGCCTAGCCATTGGCCAGTCCGTCGCA
GCAATGGAGTATCTCGACGACGTTTTCCCTCTGCCGCCCACGCTGCCGCCCGCCGGCGATGCTGCGGGCCGCGCT
GTGGTTAGGGCCCTGGTGAATATTATTTGCTGCGATGTGCAGCCCGTGACGAACCGCAAGATTATGCGGCGCGTG
ACGGAGCTGGGCGGCAATGCTGAGGAGTGGAATCGCGAGCTCATGACGGCGGGCTTGAGGGCTTATGAGCAGACG
GCCAGGGATCATGCTGGCGTCTATTCCTTTGGCGATGAGATTACCATGGCGGATATTTGTCTCGTGCCGGCCGTG
TGGAATGCCGAGAGATATGGCATTGACCTGGAGGCAGAGTTTCCCCTCATTTTTGCCATTGCTCAGAAGCTGAGT
GGCCACGATGCTGTTATCCAAGCCCACTGGGCCAGACAGCCCGACACACCCCTCGAGCTGCGTCAGGAATAG
Transcript >OphauB2|137
ATGACGCAATACTCGCTATACAGCTACTTTCGCTCCTCGTGCTCCGCGCGCCTGCGCATCATGCTGCACCTCAAA
AAGATTGCCTTTGACACGGTTCCCGTCAACATTCTCAAGAATGAGCACTCGTCAAGCTCCCACATGGCCCTCAAT
CCTTCTGGGTCCGTCCCGCTCCTCCTCTCCCACCGCAGCGAGGACCAGGGCCTAGCCATTGGCCAGTCCGTCGCA
GCAATGGAGTATCTCGACGACGTTTTCCCTCTGCCGCCCACGCTGCCGCCCGCCGGCGATGCTGCGGGCCGCGCT
GTGGTTAGGGCCCTGGTGAATATTATTTGCTGCGATGTGCAGCCCGTGACGAACCGCAAGATTATGCGGCGCGTG
ACGGAGCTGGGCGGCAATGCTGAGGAGTGGAATCGCGAGCTCATGACGGCGGGCTTGAGGGCTTATGAGCAGACG
GCCAGGGATCATGCTGGCGTCTATTCCTTTGGCGATGAGATTACCATGGCGGATATTTGTCTCGTGCCGGCCGTG
TGGAATGCCGAGAGATATGGCATTGACCTGGAGGCAGAGTTTCCCCTCATTTTTGCCATTGCTCAGAAGCTGAGT
GGCCACGATGCTGTTATCCAAGCCCACTGGGCCAGACAGCCCGACACACCCCTCGAGCTGCGTCAGGAATAG
Gene >OphauB2|137
ATGACGCAATACTCGCTATACAGCTACTTTCGCTCCTCGTGCTCCGCGCGCCTGCGCATCATGCTGCACCTCAAA
AAGATTGCCTTTGACACGGTTCCCGTCAACATTCTCAAGAATGAGCACTCGTCAAGCTCCCACATGGCCCTCAAT
CCTTCTGGGTCCGTCCCGCTCCTCCTCTCCCACCGCAGCGAGGACCAGGGCCTAGCCATTGGCCAGTCCGTCGCA
GCAATGGAGTATCTCGACGACGTTTTCCCTCTGCCGCCCACGCTGCCGCCCGCCGGCGATGCTGCGGGCCGCGCT
GTGGTTAGGGCCCTGGTGAATATTATTTGCTGCGATGTGCAGCCCGTGACGAACCGCAAGATTATGCGGCGCGTG
ACGGAGCTGGGCGGCAATGCTGAGGAGTGGAATCGCGAGCTCATGACGGCGGGCTTGAGGGCTTATGAGCAGACG
GCCAGGGATCATGCTGGCGTCTATTCCTTTGGCGATGAGATTACCATGGCGGATATTTGTCTCGTGCCGGCCGTG
TGGAATGCCGAGAGATATGGCATTGACCTGGAGGCAGAGTTTCCCCTCATTTTTGCCATTGCTCAGAAGCTGAGT
GGCCACGATGCTGTTATCCAAGCCCACTGGGCCAGACAGCCCGACACACCCCTCGAGCTGCGTCAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail