Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1365
Gene name
LocationContig_134:43648..49426
Strand+
Gene length (bp)5778
Transcript length (bp)5493
Coding sequence length (bp)5493
Protein length (aa) 1831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.3E-38 289 841
PF00501 AMP-binding AMP-binding enzyme 1.3E-25 1056 1506
PF06464 DMAP_binding DMAP1-binding Domain 1.8E-09 7 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12275|YO093_YEAST Uncharacterized protein YOR093C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR093C PE=1 SV=1 255 1643 0.0E+00
sp|Q09773|MUG62_SCHPO Meiotically up-regulated gene 62 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug62 PE=1 SV=1 261 1644 0.0E+00
sp|Q10250|YD22_SCHPO Uncharacterized protein C56F8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.02 PE=4 SV=1 256 1644 0.0E+00
sp|Q6NVJ5|DI2BA_DANRE Disco-interacting protein 2 homolog B-A OS=Danio rerio GN=dip2ba PE=2 SV=1 753 1623 7.0E-71
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus GN=Dip2b PE=1 SV=1 753 1623 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12275|YO093_YEAST Uncharacterized protein YOR093C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR093C PE=1 SV=1 255 1643 0.0E+00
sp|Q09773|MUG62_SCHPO Meiotically up-regulated gene 62 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug62 PE=1 SV=1 261 1644 0.0E+00
sp|Q10250|YD22_SCHPO Uncharacterized protein C56F8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.02 PE=4 SV=1 256 1644 0.0E+00
sp|Q6NVJ5|DI2BA_DANRE Disco-interacting protein 2 homolog B-A OS=Danio rerio GN=dip2ba PE=2 SV=1 753 1623 7.0E-71
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus GN=Dip2b PE=1 SV=1 753 1623 1.0E-66
sp|Q9Y2E4|DIP2C_HUMAN Disco-interacting protein 2 homolog C OS=Homo sapiens GN=DIP2C PE=1 SV=2 746 1635 4.0E-65
sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens GN=DIP2B PE=1 SV=3 753 1623 6.0E-65
sp|Q14689|DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens GN=DIP2A PE=1 SV=2 746 1635 4.0E-64
sp|Q9W0S9|DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster GN=DIP2 PE=1 SV=2 919 1635 5.0E-63
sp|Q8BWT5|DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus GN=Dip2a PE=1 SV=3 746 1635 1.0E-61
sp|Q14689|DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens GN=DIP2A PE=1 SV=2 281 603 5.0E-16
sp|Q8BWT5|DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus GN=Dip2a PE=1 SV=3 281 603 2.0E-15
sp|Q9W0S9|DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster GN=DIP2 PE=1 SV=2 284 564 7.0E-15
sp|Q9Y2E4|DIP2C_HUMAN Disco-interacting protein 2 homolog C OS=Homo sapiens GN=DIP2C PE=1 SV=2 220 567 7.0E-15
sp|Q6NVJ5|DI2BA_DANRE Disco-interacting protein 2 homolog B-A OS=Danio rerio GN=dip2ba PE=2 SV=1 284 629 4.0E-14
sp|Q14689|DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens GN=DIP2A PE=1 SV=2 283 475 4.0E-14
sp|Q8BWT5|DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus GN=Dip2a PE=1 SV=3 275 771 5.0E-14
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus GN=Dip2b PE=1 SV=1 284 475 7.0E-14
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 1049 1623 8.0E-14
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 283 845 5.0E-13
sp|Q6NVJ5|DI2BA_DANRE Disco-interacting protein 2 homolog B-A OS=Danio rerio GN=dip2ba PE=2 SV=1 284 475 5.0E-13
sp|Q7TXM1|FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD26 PE=1 SV=1 1051 1623 1.0E-12
sp|P9WQ43|FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD26 PE=1 SV=1 1051 1623 1.0E-12
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 1049 1623 1.0E-12
sp|P9WQ42|FAA26_MYCTO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD26 PE=3 SV=1 1051 1623 1.0E-12
sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens GN=DIP2B PE=1 SV=3 284 603 1.0E-12
sp|Q9P265|DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens GN=DIP2B PE=1 SV=3 284 475 1.0E-12
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus GN=Dip2b PE=1 SV=1 284 623 1.0E-12
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 1049 1623 2.0E-12
sp|Q9W0S9|DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster GN=DIP2 PE=1 SV=2 284 567 3.0E-12
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 1049 1627 1.0E-11
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 1049 1627 1.0E-11
sp|Q7U226|FAA30_MYCBO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD30 PE=3 SV=1 1278 1641 2.0E-11
sp|Q7TTR2|FAA32_MYCBO Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD32 PE=3 SV=1 1036 1637 2.0E-11
sp|P9WQ56|FAA30_MYCTO Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD30 PE=3 SV=1 1278 1641 2.0E-11
sp|P9WQ57|FAA30_MYCTU Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD30 PE=1 SV=1 1278 1641 2.0E-11
sp|O53580|FAA32_MYCTU Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD32 PE=1 SV=1 1036 1637 2.0E-11
sp|B2HPY8|FAA30_MYCMM Long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD30 PE=3 SV=1 1278 1578 4.0E-11
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 1081 1646 5.0E-11
sp|Q9Y2E4|DIP2C_HUMAN Disco-interacting protein 2 homolog C OS=Homo sapiens GN=DIP2C PE=1 SV=2 283 562 6.0E-11
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 619 964 1.0E-10
sp|B2HMK0|FAA32_MYCMM Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD32 PE=3 SV=1 1047 1637 1.0E-10
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 619 964 2.0E-10
sp|P9WQ58|FAA28_MYCTO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD28 PE=3 SV=1 1081 1627 3.0E-10
sp|Q02278|FAA28_MYCBO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD28 PE=3 SV=2 1081 1627 3.0E-10
sp|P9WQ59|FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD28 PE=1 SV=1 1081 1627 3.0E-10
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 1051 1653 5.0E-10
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 1051 1653 5.0E-10
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 1051 1653 5.0E-10
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 1051 1627 1.0E-09
sp|P54200|FAD21_MYCLE Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium leprae (strain TN) GN=fadD21 PE=3 SV=2 1049 1623 2.0E-09
sp|P9WQ49|FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 1049 1551 2.0E-09
sp|P9WQ48|FAD21_MYCTO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 1049 1551 2.0E-09
sp|P63524|FAD21_MYCBO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 1049 1551 2.0E-09
sp|Q3UH60|DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus GN=Dip2b PE=1 SV=1 1071 1619 5.0E-09
sp|Q7TXM1|FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD26 PE=1 SV=1 663 845 1.0E-08
sp|P9WQ43|FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD26 PE=1 SV=1 663 845 1.0E-08
sp|P9WQ42|FAA26_MYCTO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD26 PE=3 SV=1 663 845 1.0E-08
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 737 845 2.0E-08
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 737 845 2.0E-08
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 737 845 2.0E-08
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 751 957 3.0E-08
sp|Q8BWT5|DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus GN=Dip2a PE=1 SV=3 1062 1619 1.0E-07
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 649 845 2.0E-07
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 649 845 2.0E-07
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 763 845 1.0E-06
sp|P9WQ58|FAA28_MYCTO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD28 PE=3 SV=1 763 845 3.0E-06
sp|P9WQ59|FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD28 PE=1 SV=1 763 845 3.0E-06
sp|Q02278|FAA28_MYCBO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD28 PE=3 SV=2 763 845 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1365
MDDQNLELQSRLDELRRELEEGDITEKGFQKRRTILLSQYIGPPPTAYPPTQRTGLRIHSPDDAAYTSNEGHRAA
AYAALGRRDSDSTSPSSPAYRPESAYGPPGTSHGSETSPAGLLRPGGPIAGQTAMAQRDSLFLTPGSDAPTRSGT
MVSGDYAFNPDQHGNYADHQQQQQYQHHQQQHQQQQQYDGRTTTLRDSQGFFSDFAGQQHYEQHQSVEYGGPHRY
SSSEAFSPTAAMAPPMLTANDLPPPDVLEYQPPLEPREVPFAIFDPHDGNTPMSGFDNMAAVLRHRARKTAKVPA
YWVLDSKGKEIASITWDKLASRAEKVAQVIRDKSSLYRGDRVALVYRDSEVIDFAIALMGCFIAGVVAVPINDLQ
DYQRLNYILTTTQAHLALTTDNNLKTFQRDITAQKLTWPKGVEWWKTNEFGSYHPKKKEDAPPLSVPDLAYIEFS
RAPTGDLRGVVLSHRTIMHQMACLSAIVSTVPKKGPGDTFNPSLRDKNGRLIGGGAGSEILLSYLDPRQGIGMIL
GILLTVYGGHTTVWFDNKAVDVPGLYANLITKYKATVMVADYPGLKRAAYNYQQDPMTTRNFKKGMEPNFQAVKL
CLIDTLTVDGEFHEVLADRWLRPLRNSRAREVVAPMLCLPEHGGMVISVRDWLGGEERMGVPLKLERESDEDSEG
DLDDEDEREKATPSNGFGSLLGGKATTATEQNPSTELNEVLLDREALKTNEVVVTAYGDEVAKKAASEPGMVRVG
AFGYPIPDATLAVVDPETGLLASPHTIGELWVDSPSLSGGFWSAPKNTELIFHARPYKFEPGEPTPTPVEPEFLR
TGLLGTVIEGKVFVLGLYEDRIRQKVEWVEHGHEIAEYRYFFVQHMVVSIVKNVPKIYDCSAFDVFVNDEHLPVV
VLESAAASTAPLTSGGPPRQPDTALMDSLAERCMEVLMQEHHLRLYCVMMTPPNSLPRVIKNGRREIGNMLCRRE
FDLGNLACVHVKFGVEHAVLNLPIGVDPMGGIWSQIASESRADILAPADKQYSGIDRREVVIDDRTSTPLNNFSC
ITDLIQWRVARQPEELSYCTIDGRGREGKGITWRKFDARVAAVAMYLKNKARVRPGDHLVLMYTHSEEFVFAIHA
AINLGAVVIPMAPLDQNRLNEDVPAFLHIVADYNVKAVLVNQDVDHLIKLKPVASHMKQSAQILKISIPNVYNTT
KPPKQNNGLRDLGLTIDPAWIRPGYPVIVWTYWTPDQRRIAVQLGHDTILGMCKVQKETCQMTSSRPVLGCVRST
TGLGFLHTCLMGIYIGTPTYLLSPVEFAQNPMSLFVTLSRYKIKDTYATPQMLDHAMASMHAKGFALHELKNMMI
SADSRPRVDVFQKVRFHFAGVGLDRTAINTVYSHVLNPMIASRSYMCIEPIELWLDPKALRRGLVVTVDPESEPK
ALLVQDSGMVPVSTQIAIVNPESRAHCYDGEFGEIWVDSEACVKSFYGSKDAFDAERFDGRTFDGDAKVAYVRTG
DLGFLHNVSRPIGPGGALVDMQVLFVLGSIGETFEINGLSHFPMDIEHSVERSHRNIVPGGCAVFQAGGLVVVLV
EVNRKPFLASLVPVIVNAILNEHQIIVDIVAFVSKGDFPRSRLGEKQRGKILAGWVTRKLRTLAQFAIRDVDPAA
MGDAAGGALEAVSELHRESIAELDRVPSGSIRSAGAPAAASSSLRNVEPAPRIMEQEEFEQQMEQISDMAPMPDR
RPVSHYGATLPPAAPLPMGGGAVPSIPEIEVPASGYMAHETRRTSTSNAPWRPHESQVPPRIRLPGVDGREDFED
WTANSNGQEEQDWTTDAIMHMNLAGDMTSK*
Coding >OphauB2|1365
ATGGACGACCAGAATCTGGAGCTCCAATCCCGGCTCGATGAGCTACGCCGCGAGCTTGAGGAAGGAGACATTACA
GAAAAGGGCTTCCAGAAACGACGCACCATTCTGCTCTCTCAGTATATTGGTCCCCCTCCCACCGCCTATCCCCCG
ACGCAGCGTACGGGCCTGCGCATACACTCGCCTGACGATGCTGCCTACACGTCAAACGAGGGACATCGCGCCGCC
GCATATGCTGCCCTTGGCAGGAGAGACTCGGACTCGACAAGCCCCTCGTCGCCTGCCTATCGACCCGAGTCGGCA
TACGGGCCCCCGGGAACTTCTCATGGCTCCGAGACGAGTCCAGCTGGGCTGCTGCGCCCTGGAGGCCCCATAGCA
GGGCAAACCGCCATGGCACAGCGCGATTCGCTCTTTCTGACACCGGGTAGCGATGCACCTACGCGGAGCGGCACC
ATGGTCTCGGGAGACTATGCATTTAACCCAGACCAACACGGCAACTATGCCGATCATCAACAGCAGCAGCAATAT
CAGCATCACCAACAGCAGCACCAACAACAACAGCAGTACGATGGCAGAACAACCACCTTGCGCGACTCGCAAGGC
TTCTTTTCCGACTTTGCCGGACAACAGCACTACGAACAGCACCAGTCTGTTGAATATGGTGGACCGCATAGGTAC
TCGTCTAGTGAAGCCTTTTCACCAACTGCCGCCATGGCCCCTCCAATGCTCACAGCCAATGACCTTCCGCCTCCA
GACGTGCTCGAGTACCAGCCGCCCCTGGAGCCCAGAGAAGTCCCCTTTGCAATTTTTGACCCGCACGATGGAAAT
ACTCCAATGTCTGGCTTTGACAACATGGCTGCCGTGTTGCGTCATCGCGCTCGAAAAACAGCAAAGGTGCCGGCT
TACTGGGTCCTGGATAGCAAAGGCAAAGAAATTGCCTCGATTACCTGGGACAAGCTCGCCTCGAGGGCGGAAAAG
GTGGCTCAAGTGATACGAGATAAGAGCTCATTGTACCGCGGCGACCGTGTTGCCCTCGTCTATCGAGATAGCGAG
GTGATTGATTTTGCCATTGCCCTTATGGGCTGCTTCATTGCTGGCGTGGTGGCTGTGCCCATCAATGACCTGCAG
GACTACCAGCGTCTCAACTACATCTTGACCACGACGCAGGCACACCTGGCGCTTACTACGGACAACAACCTCAAG
ACATTCCAACGGGACATTACGGCACAGAAGCTTACATGGCCCAAGGGAGTCGAGTGGTGGAAGACGAACGAGTTT
GGCAGCTACCATCCCAAGAAGAAGGAAGATGCCCCTCCGCTGTCGGTTCCGGACCTGGCGTACATTGAGTTTTCG
CGAGCGCCAACAGGCGACTTGCGCGGCGTCGTCTTGAGCCATCGCACCATTATGCACCAAATGGCCTGCCTGAGC
GCCATTGTCTCGACGGTGCCCAAAAAGGGACCAGGCGATACCTTTAACCCTTCACTGCGAGACAAGAATGGTCGG
CTGATTGGCGGCGGTGCCGGAAGTGAGATACTGCTCTCGTATCTAGACCCACGTCAGGGTATTGGCATGATTCTC
GGCATCTTGTTAACCGTCTATGGCGGCCACACGACTGTCTGGTTCGACAACAAGGCAGTTGATGTGCCTGGACTG
TACGCTAATCTCATCACAAAATACAAGGCCACCGTCATGGTGGCAGATTATCCTGGCTTGAAGCGAGCAGCATAC
AATTATCAACAAGACCCAATGACGACACGCAACTTCAAAAAGGGCATGGAGCCCAACTTCCAGGCCGTCAAGCTG
TGTCTGATTGATACACTGACGGTAGATGGCGAATTCCACGAGGTGCTGGCTGATCGCTGGCTGCGGCCACTGAGA
AACAGCAGGGCTCGTGAAGTGGTGGCGCCCATGCTCTGTCTACCCGAGCATGGCGGCATGGTCATCAGTGTGCGT
GACTGGCTTGGGGGAGAAGAACGCATGGGAGTGCCATTGAAGCTGGAACGAGAGTCGGACGAGGATTCCGAGGGC
GACTTGGATGACGAGGATGAGCGAGAAAAGGCAACGCCCTCGAATGGCTTTGGCAGCTTGCTGGGCGGAAAGGCG
ACTACTGCGACTGAGCAGAATCCCAGCACTGAGCTCAATGAGGTTCTTTTGGACCGAGAGGCGCTCAAGACCAAT
GAGGTAGTGGTGACGGCATATGGGGACGAAGTTGCGAAAAAGGCGGCGAGCGAGCCAGGCATGGTGCGGGTGGGC
GCATTTGGATACCCGATTCCCGACGCGACGCTGGCTGTGGTTGACCCGGAGACGGGGCTTCTAGCATCGCCGCAC
ACGATAGGCGAGTTGTGGGTGGACTCGCCGTCGCTGTCGGGGGGCTTCTGGTCGGCACCCAAGAATACGGAGCTG
ATTTTCCATGCTCGGCCATACAAGTTCGAGCCTGGAGAACCGACTCCGACACCCGTGGAGCCCGAGTTTTTGAGA
ACGGGGCTGCTGGGCACGGTTATTGAGGGCAAAGTGTTTGTGCTTGGCCTGTACGAGGACCGGATCCGGCAAAAG
GTAGAGTGGGTAGAGCACGGGCACGAGATTGCCGAGTATCGCTACTTTTTCGTGCAGCACATGGTTGTCAGCATC
GTCAAGAATGTGCCCAAGATCTACGACTGCTCTGCCTTTGACGTCTTTGTTAACGACGAGCATCTGCCGGTGGTG
GTGCTCGAGTCGGCGGCGGCATCGACGGCGCCGCTGACATCGGGAGGGCCGCCGCGACAGCCCGACACGGCGCTG
ATGGACTCGCTGGCGGAGCGGTGCATGGAGGTGCTGATGCAGGAGCACCACTTGCGGCTGTACTGCGTCATGATG
ACGCCGCCCAACTCGCTGCCGCGCGTCATCAAGAACGGGCGGCGCGAGATTGGCAACATGCTGTGCCGGCGCGAG
TTTGACCTGGGCAACCTGGCGTGCGTGCACGTCAAGTTTGGCGTTGAGCACGCGGTGCTGAACCTGCCCATTGGC
GTGGACCCCATGGGCGGCATCTGGTCGCAGATTGCGTCGGAGTCACGGGCGGATATCCTGGCGCCGGCCGACAAG
CAGTATTCAGGCATTGACCGGCGCGAAGTGGTGATTGACGACCGCACGTCGACGCCGCTCAACAACTTTTCGTGC
ATCACGGACCTGATTCAGTGGCGCGTTGCCCGGCAGCCCGAGGAGCTCTCGTACTGCACCATTGACGGCCGTGGG
CGCGAGGGCAAGGGCATCACGTGGCGCAAGTTTGATGCCCGCGTGGCTGCCGTGGCCATGTATCTCAAGAACAAG
GCGCGCGTGCGGCCTGGCGACCACTTGGTGCTCATGTACACGCACTCGGAGGAGTTTGTCTTTGCCATTCACGCT
GCCATCAACCTGGGCGCCGTGGTGATTCCCATGGCGCCGCTCGACCAGAACCGACTTAATGAGGATGTTCCCGCC
TTTTTGCACATTGTCGCCGACTACAATGTCAAGGCGGTGCTGGTGAACCAAGACGTTGACCATCTCATCAAGCTC
AAGCCCGTTGCCAGCCACATGAAGCAGTCGGCGCAGATTCTCAAGATTTCCATTCCAAACGTCTACAACACGACC
AAGCCGCCCAAGCAGAACAATGGGCTGCGCGATCTGGGGCTGACGATTGACCCGGCCTGGATAAGGCCCGGCTAT
CCAGTCATTGTGTGGACGTATTGGACGCCTGACCAGCGGCGCATTGCCGTGCAGCTGGGCCACGACACCATTCTG
GGCATGTGCAAGGTGCAAAAGGAGACGTGCCAGATGACGAGCTCGCGCCCGGTGCTTGGGTGCGTTCGCAGCACC
ACGGGCCTGGGCTTCTTGCACACGTGCCTCATGGGCATCTACATTGGCACGCCGACATATCTGCTGTCGCCCGTT
GAGTTTGCGCAGAACCCCATGTCCTTGTTTGTCACACTGTCTAGGTACAAGATCAAGGACACGTATGCTACGCCG
CAAATGCTCGACCACGCCATGGCCTCGATGCACGCCAAGGGCTTTGCCTTGCACGAGCTCAAGAACATGATGATT
AGCGCCGACAGCCGCCCGCGCGTCGATGTCTTCCAAAAGGTGCGCTTCCACTTTGCCGGCGTTGGGCTCGACAGG
ACCGCCATCAACACGGTCTACTCGCACGTGCTCAACCCCATGATTGCCTCGCGATCCTACATGTGCATCGAGCCT
ATTGAGCTGTGGCTGGATCCCAAGGCGCTGCGACGCGGCCTGGTGGTGACTGTTGACCCCGAGTCTGAGCCCAAG
GCTCTGCTGGTGCAAGACTCGGGCATGGTTCCCGTGTCGACGCAGATTGCCATTGTCAATCCAGAGAGCCGGGCG
CACTGCTATGACGGAGAATTTGGAGAGATTTGGGTCGACTCGGAGGCTTGTGTCAAGTCGTTTTACGGCTCCAAG
GACGCCTTTGATGCAGAGCGCTTTGACGGCCGCACCTTTGACGGAGACGCCAAGGTTGCCTATGTACGAACGGGC
GACTTGGGCTTTCTGCACAATGTCAGCCGGCCTATTGGTCCCGGAGGCGCCTTGGTGGATATGCAGGTGCTCTTT
GTGCTGGGCAGCATTGGCGAGACGTTTGAAATCAATGGCCTGAGCCATTTCCCCATGGATATTGAGCACTCGGTG
GAGCGGTCGCACCGCAACATTGTGCCTGGTGGCTGTGCCGTTTTCCAAGCCGGCGGGCTAGTGGTTGTCCTGGTG
GAAGTGAACCGCAAGCCCTTTTTAGCATCGCTAGTGCCCGTCATTGTCAATGCCATTCTCAATGAGCATCAAATC
ATTGTCGACATTGTCGCCTTTGTCAGCAAGGGCGACTTTCCCCGGTCTCGGCTCGGGGAGAAGCAGCGAGGCAAA
ATCTTGGCTGGATGGGTGACGCGTAAGCTGCGCACGCTGGCACAGTTTGCTATTCGCGACGTGGACCCGGCGGCT
ATGGGCGACGCGGCCGGCGGCGCCCTCGAGGCGGTCAGCGAGCTTCATAGGGAGAGCATTGCAGAGCTTGATAGG
GTACCCTCGGGCAGCATCCGTAGTGCTGGCGCGCCCGCTGCGGCTTCGTCGAGCCTGCGCAACGTGGAGCCTGCT
CCGCGCATCATGGAGCAGGAAGAGTTTGAGCAGCAAATGGAGCAAATTTCCGACATGGCGCCCATGCCTGACCGC
CGGCCCGTGTCTCACTATGGCGCCACCCTCCCGCCAGCCGCTCCTCTACCCATGGGAGGCGGCGCCGTGCCCAGC
ATCCCCGAGATTGAGGTGCCAGCATCTGGATACATGGCGCACGAGACGCGTCGGACGAGCACTTCTAATGCGCCG
TGGAGACCGCACGAGAGTCAAGTGCCTCCGCGGATACGCCTTCCGGGAGTTGACGGGCGCGAGGACTTTGAAGAC
TGGACGGCAAACAGCAATGGCCAAGAAGAGCAAGACTGGACGACGGATGCCATTATGCACATGAATCTCGCTGGA
GATATGACGTCCAAGTGA
Transcript >OphauB2|1365
ATGGACGACCAGAATCTGGAGCTCCAATCCCGGCTCGATGAGCTACGCCGCGAGCTTGAGGAAGGAGACATTACA
GAAAAGGGCTTCCAGAAACGACGCACCATTCTGCTCTCTCAGTATATTGGTCCCCCTCCCACCGCCTATCCCCCG
ACGCAGCGTACGGGCCTGCGCATACACTCGCCTGACGATGCTGCCTACACGTCAAACGAGGGACATCGCGCCGCC
GCATATGCTGCCCTTGGCAGGAGAGACTCGGACTCGACAAGCCCCTCGTCGCCTGCCTATCGACCCGAGTCGGCA
TACGGGCCCCCGGGAACTTCTCATGGCTCCGAGACGAGTCCAGCTGGGCTGCTGCGCCCTGGAGGCCCCATAGCA
GGGCAAACCGCCATGGCACAGCGCGATTCGCTCTTTCTGACACCGGGTAGCGATGCACCTACGCGGAGCGGCACC
ATGGTCTCGGGAGACTATGCATTTAACCCAGACCAACACGGCAACTATGCCGATCATCAACAGCAGCAGCAATAT
CAGCATCACCAACAGCAGCACCAACAACAACAGCAGTACGATGGCAGAACAACCACCTTGCGCGACTCGCAAGGC
TTCTTTTCCGACTTTGCCGGACAACAGCACTACGAACAGCACCAGTCTGTTGAATATGGTGGACCGCATAGGTAC
TCGTCTAGTGAAGCCTTTTCACCAACTGCCGCCATGGCCCCTCCAATGCTCACAGCCAATGACCTTCCGCCTCCA
GACGTGCTCGAGTACCAGCCGCCCCTGGAGCCCAGAGAAGTCCCCTTTGCAATTTTTGACCCGCACGATGGAAAT
ACTCCAATGTCTGGCTTTGACAACATGGCTGCCGTGTTGCGTCATCGCGCTCGAAAAACAGCAAAGGTGCCGGCT
TACTGGGTCCTGGATAGCAAAGGCAAAGAAATTGCCTCGATTACCTGGGACAAGCTCGCCTCGAGGGCGGAAAAG
GTGGCTCAAGTGATACGAGATAAGAGCTCATTGTACCGCGGCGACCGTGTTGCCCTCGTCTATCGAGATAGCGAG
GTGATTGATTTTGCCATTGCCCTTATGGGCTGCTTCATTGCTGGCGTGGTGGCTGTGCCCATCAATGACCTGCAG
GACTACCAGCGTCTCAACTACATCTTGACCACGACGCAGGCACACCTGGCGCTTACTACGGACAACAACCTCAAG
ACATTCCAACGGGACATTACGGCACAGAAGCTTACATGGCCCAAGGGAGTCGAGTGGTGGAAGACGAACGAGTTT
GGCAGCTACCATCCCAAGAAGAAGGAAGATGCCCCTCCGCTGTCGGTTCCGGACCTGGCGTACATTGAGTTTTCG
CGAGCGCCAACAGGCGACTTGCGCGGCGTCGTCTTGAGCCATCGCACCATTATGCACCAAATGGCCTGCCTGAGC
GCCATTGTCTCGACGGTGCCCAAAAAGGGACCAGGCGATACCTTTAACCCTTCACTGCGAGACAAGAATGGTCGG
CTGATTGGCGGCGGTGCCGGAAGTGAGATACTGCTCTCGTATCTAGACCCACGTCAGGGTATTGGCATGATTCTC
GGCATCTTGTTAACCGTCTATGGCGGCCACACGACTGTCTGGTTCGACAACAAGGCAGTTGATGTGCCTGGACTG
TACGCTAATCTCATCACAAAATACAAGGCCACCGTCATGGTGGCAGATTATCCTGGCTTGAAGCGAGCAGCATAC
AATTATCAACAAGACCCAATGACGACACGCAACTTCAAAAAGGGCATGGAGCCCAACTTCCAGGCCGTCAAGCTG
TGTCTGATTGATACACTGACGGTAGATGGCGAATTCCACGAGGTGCTGGCTGATCGCTGGCTGCGGCCACTGAGA
AACAGCAGGGCTCGTGAAGTGGTGGCGCCCATGCTCTGTCTACCCGAGCATGGCGGCATGGTCATCAGTGTGCGT
GACTGGCTTGGGGGAGAAGAACGCATGGGAGTGCCATTGAAGCTGGAACGAGAGTCGGACGAGGATTCCGAGGGC
GACTTGGATGACGAGGATGAGCGAGAAAAGGCAACGCCCTCGAATGGCTTTGGCAGCTTGCTGGGCGGAAAGGCG
ACTACTGCGACTGAGCAGAATCCCAGCACTGAGCTCAATGAGGTTCTTTTGGACCGAGAGGCGCTCAAGACCAAT
GAGGTAGTGGTGACGGCATATGGGGACGAAGTTGCGAAAAAGGCGGCGAGCGAGCCAGGCATGGTGCGGGTGGGC
GCATTTGGATACCCGATTCCCGACGCGACGCTGGCTGTGGTTGACCCGGAGACGGGGCTTCTAGCATCGCCGCAC
ACGATAGGCGAGTTGTGGGTGGACTCGCCGTCGCTGTCGGGGGGCTTCTGGTCGGCACCCAAGAATACGGAGCTG
ATTTTCCATGCTCGGCCATACAAGTTCGAGCCTGGAGAACCGACTCCGACACCCGTGGAGCCCGAGTTTTTGAGA
ACGGGGCTGCTGGGCACGGTTATTGAGGGCAAAGTGTTTGTGCTTGGCCTGTACGAGGACCGGATCCGGCAAAAG
GTAGAGTGGGTAGAGCACGGGCACGAGATTGCCGAGTATCGCTACTTTTTCGTGCAGCACATGGTTGTCAGCATC
GTCAAGAATGTGCCCAAGATCTACGACTGCTCTGCCTTTGACGTCTTTGTTAACGACGAGCATCTGCCGGTGGTG
GTGCTCGAGTCGGCGGCGGCATCGACGGCGCCGCTGACATCGGGAGGGCCGCCGCGACAGCCCGACACGGCGCTG
ATGGACTCGCTGGCGGAGCGGTGCATGGAGGTGCTGATGCAGGAGCACCACTTGCGGCTGTACTGCGTCATGATG
ACGCCGCCCAACTCGCTGCCGCGCGTCATCAAGAACGGGCGGCGCGAGATTGGCAACATGCTGTGCCGGCGCGAG
TTTGACCTGGGCAACCTGGCGTGCGTGCACGTCAAGTTTGGCGTTGAGCACGCGGTGCTGAACCTGCCCATTGGC
GTGGACCCCATGGGCGGCATCTGGTCGCAGATTGCGTCGGAGTCACGGGCGGATATCCTGGCGCCGGCCGACAAG
CAGTATTCAGGCATTGACCGGCGCGAAGTGGTGATTGACGACCGCACGTCGACGCCGCTCAACAACTTTTCGTGC
ATCACGGACCTGATTCAGTGGCGCGTTGCCCGGCAGCCCGAGGAGCTCTCGTACTGCACCATTGACGGCCGTGGG
CGCGAGGGCAAGGGCATCACGTGGCGCAAGTTTGATGCCCGCGTGGCTGCCGTGGCCATGTATCTCAAGAACAAG
GCGCGCGTGCGGCCTGGCGACCACTTGGTGCTCATGTACACGCACTCGGAGGAGTTTGTCTTTGCCATTCACGCT
GCCATCAACCTGGGCGCCGTGGTGATTCCCATGGCGCCGCTCGACCAGAACCGACTTAATGAGGATGTTCCCGCC
TTTTTGCACATTGTCGCCGACTACAATGTCAAGGCGGTGCTGGTGAACCAAGACGTTGACCATCTCATCAAGCTC
AAGCCCGTTGCCAGCCACATGAAGCAGTCGGCGCAGATTCTCAAGATTTCCATTCCAAACGTCTACAACACGACC
AAGCCGCCCAAGCAGAACAATGGGCTGCGCGATCTGGGGCTGACGATTGACCCGGCCTGGATAAGGCCCGGCTAT
CCAGTCATTGTGTGGACGTATTGGACGCCTGACCAGCGGCGCATTGCCGTGCAGCTGGGCCACGACACCATTCTG
GGCATGTGCAAGGTGCAAAAGGAGACGTGCCAGATGACGAGCTCGCGCCCGGTGCTTGGGTGCGTTCGCAGCACC
ACGGGCCTGGGCTTCTTGCACACGTGCCTCATGGGCATCTACATTGGCACGCCGACATATCTGCTGTCGCCCGTT
GAGTTTGCGCAGAACCCCATGTCCTTGTTTGTCACACTGTCTAGGTACAAGATCAAGGACACGTATGCTACGCCG
CAAATGCTCGACCACGCCATGGCCTCGATGCACGCCAAGGGCTTTGCCTTGCACGAGCTCAAGAACATGATGATT
AGCGCCGACAGCCGCCCGCGCGTCGATGTCTTCCAAAAGGTGCGCTTCCACTTTGCCGGCGTTGGGCTCGACAGG
ACCGCCATCAACACGGTCTACTCGCACGTGCTCAACCCCATGATTGCCTCGCGATCCTACATGTGCATCGAGCCT
ATTGAGCTGTGGCTGGATCCCAAGGCGCTGCGACGCGGCCTGGTGGTGACTGTTGACCCCGAGTCTGAGCCCAAG
GCTCTGCTGGTGCAAGACTCGGGCATGGTTCCCGTGTCGACGCAGATTGCCATTGTCAATCCAGAGAGCCGGGCG
CACTGCTATGACGGAGAATTTGGAGAGATTTGGGTCGACTCGGAGGCTTGTGTCAAGTCGTTTTACGGCTCCAAG
GACGCCTTTGATGCAGAGCGCTTTGACGGCCGCACCTTTGACGGAGACGCCAAGGTTGCCTATGTACGAACGGGC
GACTTGGGCTTTCTGCACAATGTCAGCCGGCCTATTGGTCCCGGAGGCGCCTTGGTGGATATGCAGGTGCTCTTT
GTGCTGGGCAGCATTGGCGAGACGTTTGAAATCAATGGCCTGAGCCATTTCCCCATGGATATTGAGCACTCGGTG
GAGCGGTCGCACCGCAACATTGTGCCTGGTGGCTGTGCCGTTTTCCAAGCCGGCGGGCTAGTGGTTGTCCTGGTG
GAAGTGAACCGCAAGCCCTTTTTAGCATCGCTAGTGCCCGTCATTGTCAATGCCATTCTCAATGAGCATCAAATC
ATTGTCGACATTGTCGCCTTTGTCAGCAAGGGCGACTTTCCCCGGTCTCGGCTCGGGGAGAAGCAGCGAGGCAAA
ATCTTGGCTGGATGGGTGACGCGTAAGCTGCGCACGCTGGCACAGTTTGCTATTCGCGACGTGGACCCGGCGGCT
ATGGGCGACGCGGCCGGCGGCGCCCTCGAGGCGGTCAGCGAGCTTCATAGGGAGAGCATTGCAGAGCTTGATAGG
GTACCCTCGGGCAGCATCCGTAGTGCTGGCGCGCCCGCTGCGGCTTCGTCGAGCCTGCGCAACGTGGAGCCTGCT
CCGCGCATCATGGAGCAGGAAGAGTTTGAGCAGCAAATGGAGCAAATTTCCGACATGGCGCCCATGCCTGACCGC
CGGCCCGTGTCTCACTATGGCGCCACCCTCCCGCCAGCCGCTCCTCTACCCATGGGAGGCGGCGCCGTGCCCAGC
ATCCCCGAGATTGAGGTGCCAGCATCTGGATACATGGCGCACGAGACGCGTCGGACGAGCACTTCTAATGCGCCG
TGGAGACCGCACGAGAGTCAAGTGCCTCCGCGGATACGCCTTCCGGGAGTTGACGGGCGCGAGGACTTTGAAGAC
TGGACGGCAAACAGCAATGGCCAAGAAGAGCAAGACTGGACGACGGATGCCATTATGCACATGAATCTCGCTGGA
GATATGACGTCCAAGTGA
Gene >OphauB2|1365
ATGGACGACCAGAATCTGGAGCTCCAATCCCGGCTCGATGAGCTACGCCGCGAGCTTGAGGTATGCCTGCCTTGT
CTTGTGGCGCTGTCGCCTCTGCGGCTGTGTCTAGAGACTCGTTTTGCTCTCATTTTGTTCTCATTTTGCTCTTGG
CCCCGTTTAAACGCTGACGTTGAACTGCTGCACAGGAAGGAGACATTACAGAAAAGGGGTAAGCAAAGTCGGGGC
CAGCGCTGTGTCAATTGTCTGCTGCGTCTGCACCAAATCTCCCTTTGTCGTGCACAGCCCAAGTCGTCGTCTGAC
GGCCAAAACTTGCAGCTTCCAGAAACGACGCACCATTCTGCTCTCTCAGTATATTGGTCCCCCTCCCACCGCCTA
TCCCCCGACGCAGCGTACGGGCCTGCGCATACACTCGCCTGACGATGCTGCCTACACGTCAAACGAGGGACATCG
CGCCGCCGCATATGCTGCCCTTGGCAGGAGAGACTCGGACTCGACAAGCCCCTCGTCGCCTGCCTATCGACCCGA
GTCGGCATACGGGCCCCCGGGAACTTCTCATGGCTCCGAGACGAGTCCAGCTGGGCTGCTGCGCCCTGGAGGCCC
CATAGCAGGGCAAACCGCCATGGCACAGCGCGATTCGCTCTTTCTGACACCGGGTAGCGATGCACCTACGCGGAG
CGGCACCATGGTCTCGGGAGACTATGCATTTAACCCAGACCAACACGGCAACTATGCCGATCATCAACAGCAGCA
GCAATATCAGCATCACCAACAGCAGCACCAACAACAACAGCAGTACGATGGCAGAACAACCACCTTGCGCGACTC
GCAAGGCTTCTTTTCCGACTTTGCCGGACAACAGCACTACGAACAGCACCAGTCTGTTGAATATGGTGGACCGCA
TAGGTACTCGTCTAGTGAAGCCTTTTCACCAACTGCCGCCATGGCCCCTCCAATGCTCACAGCCAATGACCTTCC
GCCTCCAGACGTGCTCGAGTACCAGCCGCCCCTGGAGCCCAGAGAAGTCCCCTTTGCAATTTTTGACCCGCACGA
TGGAAATACTCCAATGTCTGGCTTTGACAACATGGCTGCCGTGTTGCGTCATCGCGCTCGAAAAACAGCAAAGGT
GCCGGCTTACTGGGTCCTGGATAGCAAAGGCAAAGAAATTGCCTCGATTACCTGGGACAAGCTCGCCTCGAGGGC
GGAAAAGGTGGCTCAAGTGATACGAGATAAGAGCTCATTGTACCGCGGCGACCGTGTTGCCCTCGTCTATCGAGA
TAGCGAGGTGATTGATTTTGCCATTGCCCTTATGGGCTGCTTCATTGCTGGCGTGGTGGCTGTGCCCATCAATGA
CCTGCAGGACTACCAGCGTCTCAACTACATCTTGACCACGACGCAGGCACACCTGGCGCTTACTACGGACAACAA
CCTCAAGACATTCCAACGGGACATTACGGCACAGAAGCTTACATGGCCCAAGGGAGTCGAGTGGTGGAAGACGAA
CGAGTTTGGCAGCTACCATCCCAAGAAGAAGGAAGATGCCCCTCCGCTGTCGGTTCCGGACCTGGCGTACATTGA
GTTTTCGCGAGCGCCAACAGGCGACTTGCGCGGCGTCGTCTTGAGCCATCGCACCATTATGCACCAAATGGCCTG
CCTGAGCGCCATTGTCTCGACGGTGCCCAAAAAGGGACCAGGCGATACCTTTAACCCTTCACTGCGAGACAAGAA
TGGTCGGCTGATTGGCGGCGGTGCCGGAAGTGAGATACTGCTCTCGTATCTAGACCCACGTCAGGGTATTGGCAT
GATTCTCGGCATCTTGTTAACCGTCTATGGCGGCCACACGACTGTCTGGTTCGACAACAAGGCAGTTGATGTGCC
TGGACTGTACGCTAATCTCATCACAAAATACAAGGCCACCGTCATGGTGGCAGATTATCCTGGCTTGAAGCGAGC
AGCATACAATTATCAACAAGACCCAATGACGACACGCAACTTCAAAAAGGGCATGGAGCCCAACTTCCAGGCCGT
CAAGCTGTGTCTGATTGATACACTGACGGTAGATGGCGAATTCCACGAGGTGCTGGCTGATCGCTGGCTGCGGCC
ACTGAGAAACAGCAGGGCTCGTGAAGTGGTGGCGCCCATGCTCTGTCTACCCGAGCATGGCGGCATGGTCATCAG
TGTGCGTGACTGGCTTGGGGGAGAAGAACGCATGGGAGTGCCATTGAAGCTGGAACGAGAGTCGGACGAGGATTC
CGAGGGCGACTTGGATGACGAGGATGAGCGAGAAAAGGCAACGCCCTCGAATGGCTTTGGCAGCTTGCTGGGCGG
AAAGGCGACTACTGCGACTGAGCAGAATCCCAGCACTGAGCTCAATGAGGTTCTTTTGGACCGAGAGGCGCTCAA
GACCAATGAGGTAGTGGTGACGGCATATGGGGACGAAGTTGCGAAAAAGGCGGCGAGCGAGCCAGGCATGGTGCG
GGTGGGCGCATTTGGATACCCGATTCCCGACGCGACGCTGGCTGTGGTTGACCCGGAGACGGGGCTTCTAGCATC
GCCGCACACGATAGGCGAGTTGTGGGTGGACTCGCCGTCGCTGTCGGGGGGCTTCTGGTCGGCACCCAAGAATAC
GGAGCTGATTTTCCATGCTCGGCCATACAAGTTCGAGCCTGGAGAACCGACTCCGACACCCGTGGAGCCCGAGTT
TTTGAGAACGGGGCTGCTGGGCACGGTTATTGAGGGCAAAGTGTTTGTGCTTGGCCTGTACGAGGACCGGATCCG
GCAAAAGGTAGAGTGGGTAGAGCACGGGCACGAGATTGCCGAGTATCGCTACTTTTTCGTGCAGCACATGGTTGT
CAGCATCGTCAAGAATGTGCCCAAGATCTACGACTGCTCTGCCTTTGACGTCTTTGTTAACGACGAGCATCTGCC
GGTGGTGGTGCTCGAGTCGGCGGCGGCATCGACGGCGCCGCTGACATCGGGAGGGCCGCCGCGACAGCCCGACAC
GGCGCTGATGGACTCGCTGGCGGAGCGGTGCATGGAGGTGCTGATGCAGGAGCACCACTTGCGGCTGTACTGCGT
CATGATGACGCCGCCCAACTCGCTGCCGCGCGTCATCAAGAACGGGCGGCGCGAGATTGGCAACATGCTGTGCCG
GCGCGAGTTTGACCTGGGCAACCTGGCGTGCGTGCACGTCAAGTTTGGCGTTGAGCACGCGGTGCTGAACCTGCC
CATTGGCGTGGACCCCATGGGCGGCATCTGGTCGCAGATTGCGTCGGAGTCACGGGCGGATATCCTGGCGCCGGC
CGACAAGCAGTATTCAGGCATTGACCGGCGCGAAGTGGTGATTGACGACCGCACGTCGACGCCGCTCAACAACTT
TTCGTGCATCACGGACCTGATTCAGTGGCGCGTTGCCCGGCAGCCCGAGGAGCTCTCGTACTGCACCATTGACGG
CCGTGGGCGCGAGGGCAAGGGCATCACGTGGCGCAAGTTTGATGCCCGCGTGGCTGCCGTGGCCATGTATCTCAA
GAACAAGGCGCGCGTGCGGCCTGGCGACCACTTGGTGCTCATGTACACGCACTCGGAGGAGTTTGTCTTTGCCAT
TCACGCTGCCATCAACCTGGGCGCCGTGGTGATTCCCATGGCGCCGCTCGACCAGAACCGACTTAATGAGGATGT
TCCCGCCTTTTTGCACATTGTCGCCGACTACAATGTCAAGGCGGTGCTGGTGAACCAAGACGTTGACCATCTCAT
CAAGCTCAAGCCCGTTGCCAGCCACATGAAGCAGTCGGCGCAGATTCTCAAGATTTCCATTCCAAACGTCTACAA
CACGACCAAGCCGCCCAAGCAGAACAATGGGCTGCGCGATCTGGGGCTGACGATTGACCCGGCCTGGATAAGGCC
CGGCTATCCAGTCATTGTGTGGACGTATTGGACGCCTGACCAGCGGCGCATTGCCGTGCAGCTGGGCCACGACAC
CATTCTGGGCATGTGCAAGGTGCAAAAGGAGACGTGCCAGATGACGAGCTCGCGCCCGGTGCTTGGGTGCGTTCG
CAGCACCACGGGCCTGGGCTTCTTGCACACGTGCCTCATGGGCATCTACATTGGCACGCCGACATATCTGCTGTC
GCCCGTTGAGTTTGCGCAGAACCCCATGTCCTTGTTTGTCACACTGTCTAGGTACAAGATCAAGGACACGTATGC
TACGCCGCAAATGCTCGACCACGCCATGGCCTCGATGCACGCCAAGGGCTTTGCCTTGCACGAGCTCAAGAACAT
GATGATTAGCGCCGACAGCCGCCCGCGCGTCGATGTCTTCCAAAAGGTGCGCTTCCACTTTGCCGGCGTTGGGCT
CGACAGGACCGCCATCAACACGGTCTACTCGCACGTGCTCAACCCCATGATTGCCTCGCGATCCTACATGTGCAT
CGAGCCTATTGAGCTGTGGCTGGATCCCAAGGCGCTGCGACGCGGCCTGGTGGTGACTGTTGACCCCGAGTCTGA
GCCCAAGGCTCTGCTGGTGCAAGACTCGGGCATGGTTCCCGTGTCGACGCAGATTGCCATTGTCAATCCAGAGAG
CCGGGCGCACTGCTATGACGGAGAATTTGGAGAGATTTGGGTCGACTCGGAGGCTTGTGTCAAGTCGTTTTACGG
CTCCAAGGACGCCTTTGATGCAGAGCGCTTTGACGGCCGCACCTTTGACGGAGACGCCAAGGTTGCCTATGTACG
AACGGGCGACTTGGGCTTTCTGCACAATGTCAGCCGGCCTATTGGTCCCGGAGGCGCCTTGGTGGATATGCAGGT
GCTCTTTGTGCTGGGCAGCATTGGCGAGACGTTTGAAATCAATGGCCTGAGCCATTTCCCCATGGATATTGAGCA
CTCGGTGGAGCGGTCGCACCGCAACATTGTGCCTGGTGGCTGGTGAGTTGAAAGCAAGGGCCGACTGGCATGGCT
GTATGCTGACTTGAGCACAGTGCCGTTTTCCAAGCCGGCGGGCTAGTGGTTGTCCTGGTGGAAGTGAACCGCAAG
CCCTTTTTAGCATCGCTAGTGCCCGTCATTGTCAATGCCATTCTCAATGAGCATCAAATCATTGTCGACATTGTC
GCCTTTGTCAGCAAGGGCGACTTTCCCCGGTCTCGGCTCGGGGAGAAGCAGCGAGGCAAAATCTTGGCTGGATGG
GTGACGCGTAAGCTGCGCACGCTGGCACAGTTTGCTATTCGCGACGTGGACCCGGCGGCTATGGGCGACGCGGCC
GGCGGCGCCCTCGAGGCGGTCAGCGAGCTTCATAGGGAGAGCATTGCAGAGCTTGATAGGGTACCCTCGGGCAGC
ATCCGTAGTGCTGGCGCGCCCGCTGCGGCTTCGTCGAGCCTGCGCAACGTGGAGCCTGCTCCGCGCATCATGGAG
CAGGAAGAGTTTGAGCAGCAAATGGAGCAAATTTCCGACATGGCGCCCATGCCTGACCGCCGGCCCGTGTCTCAC
TATGGCGCCACCCTCCCGCCAGCCGCTCCTCTACCCATGGGAGGCGGCGCCGTGCCCAGCATCCCCGAGATTGAG
GTGCCAGCATCTGGATACATGGCGCACGAGACGCGTCGGACGAGCACTTCTAATGCGCCGTGGAGACCGCACGAG
AGTCAAGTGCCTCCGCGGATACGCCTTCCGGGAGTTGACGGGCGCGAGGACTTTGAAGACTGGACGGCAAACAGC
AATGGCCAAGAAGAGCAAGACTGGACGACGGATGCCATTATGCACATGAATCTCGCTGGAGATATGACGTCCAAG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail