Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1360
Gene name
LocationContig_134:32208..34014
Strand-
Gene length (bp)1806
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02112 PDEase_II cAMP phosphodiesterases class-II 3.4E-44 99 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32782|PDE1_CANAX 3',5'-cyclic-nucleotide phosphodiesterase OS=Candida albicans GN=PDE1 PE=3 SV=2 12 388 3.0E-20
sp|P36599|PDE1_SCHPO 3',5'-cyclic-nucleotide phosphodiesterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgs2 PE=3 SV=1 17 175 1.0E-16
sp|P22434|PDE1_YEAST 3',5'-cyclic-nucleotide phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDE1 PE=1 SV=2 11 166 5.0E-15
sp|Q8ZD92|CPDP_YERPE Probable 3',5'-cyclic-nucleotide phosphodiesterase OS=Yersinia pestis GN=cpdP PE=3 SV=1 12 192 2.0E-13
sp|Q56686|CPDP_ALIFS 3',5'-cyclic-nucleotide phosphodiesterase OS=Aliivibrio fischeri GN=cpdP PE=3 SV=1 12 175 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32782|PDE1_CANAX 3',5'-cyclic-nucleotide phosphodiesterase OS=Candida albicans GN=PDE1 PE=3 SV=2 12 388 3.0E-20
sp|P36599|PDE1_SCHPO 3',5'-cyclic-nucleotide phosphodiesterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgs2 PE=3 SV=1 17 175 1.0E-16
sp|P22434|PDE1_YEAST 3',5'-cyclic-nucleotide phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDE1 PE=1 SV=2 11 166 5.0E-15
sp|Q8ZD92|CPDP_YERPE Probable 3',5'-cyclic-nucleotide phosphodiesterase OS=Yersinia pestis GN=cpdP PE=3 SV=1 12 192 2.0E-13
sp|Q56686|CPDP_ALIFS 3',5'-cyclic-nucleotide phosphodiesterase OS=Aliivibrio fischeri GN=cpdP PE=3 SV=1 12 175 3.0E-10
sp|P36599|PDE1_SCHPO 3',5'-cyclic-nucleotide phosphodiesterase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cgs2 PE=3 SV=1 293 383 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004115 3',5'-cyclic-AMP phosphodiesterase activity Yes
GO:0006198 cAMP catabolic process Yes
GO:1901565 organonitrogen compound catabolic process No
GO:0009214 cyclic nucleotide catabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009154 purine ribonucleotide catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0009166 nucleotide catabolic process No
GO:0009187 cyclic nucleotide metabolic process No
GO:0046700 heterocycle catabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity No
GO:0016787 hydrolase activity No
GO:0019693 ribose phosphate metabolic process No
GO:0008150 biological_process No
GO:0046058 cAMP metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901292 nucleoside phosphate catabolic process No
GO:0072523 purine-containing compound catabolic process No
GO:0009261 ribonucleotide catabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:1901575 organic substance catabolic process No
GO:0004112 cyclic-nucleotide phosphodiesterase activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0046434 organophosphate catabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009117 nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0009056 catabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006195 purine nucleotide catabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0044248 cellular catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003824 catalytic activity No
GO:0019637 organophosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008081 phosphoric diester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1360
MGHADHHDAPVLHVVVLGAGGGPQESNITAMLVRSVSQHWAKGSVVAVDAGIHLSAIARLIGESSSPRSSPQSQD
DDVPPRLAHGPLQGLPLPCRSVEANAAHVVRTLVDTYLITHPHLDHISGLVVNTAGLSASRPKKIAGLPSTIQAL
KNHIFNNIIWPNLSDENNGAGLLTYLRLVEGGSPALGHGSSRGYVEVCDGLLVKAWSVSHGHCIERHAHRGSASA
ASASFSCPSPRYGSHDGSAATQPQPPHGRASMLGSGAATGASGAGGASPQIYGAGSMMEQERYCVYDSSAYFIQD
HQHRREVLIFGDVEPDSISLHPRNLAVWQEAAPKIAAGLLTAIFIECSYDDSQSNDRLFGHLKPVFVIQELHVLA
AEVEAARVAAVAAAAAAAAATADSGSASDTASTRKRKRTSLGAGSGAENRRPSVPIRRQSAAATVHFQDPFAPKP
LGQPSCPSPNKLPSFATPPPPPPQAAPGAAAPANGTVQVATPTKEDEVAHVEPAAIETPAMRPLQGLKVVIIHVK
EKLTDEEPAIGERIMEQLNEHERTAQLGCEFVVSYPGQSFYL*
Coding >OphauB2|1360
ATGGGCCATGCCGACCACCATGACGCCCCCGTCTTGCACGTTGTTGTGCTGGGCGCTGGCGGCGGCCCTCAGGAA
TCCAACATAACCGCCATGCTGGTGCGCTCCGTCTCCCAGCACTGGGCCAAGGGTTCCGTTGTCGCCGTCGATGCC
GGCATCCACCTGTCCGCCATTGCCCGCTTGATAGGAGAATCGTCATCCCCGCGCTCTTCGCCTCAGTCGCAAGAC
GACGACGTGCCGCCCCGATTAGCCCACGGGCCTTTGCAAGGCTTGCCATTGCCTTGCCGCTCCGTCGAGGCCAAT
GCAGCCCACGTTGTGCGCACGCTTGTCGACACCTATCTCATTACCCATCCTCACCTCGACCACATCTCGGGCCTC
GTGGTCAACACAGCTGGCCTGTCGGCCTCGCGTCCCAAGAAGATTGCCGGCCTGCCCTCTACCATTCAAGCACTC
AAGAACCACATCTTCAACAACATCATTTGGCCTAATCTTAGCGACGAGAACAACGGCGCCGGCCTGTTGACGTAT
CTGCGTCTTGTCGAGGGCGGCAGTCCGGCTCTCGGCCATGGCTCTAGCAGGGGCTACGTCGAAGTATGTGACGGC
TTGCTCGTCAAGGCCTGGAGCGTCAGCCACGGCCACTGCATCGAGCGACATGCCCATCGTGGCTCTGCCTCGGCT
GCCTCGGCCTCGTTTTCCTGTCCATCGCCGCGCTACGGCAGCCACGATGGGTCTGCTGCCACTCAGCCCCAGCCG
CCTCATGGGCGTGCCTCGATGCTCGGGAGTGGAGCTGCCACTGGTGCGTCGGGTGCTGGCGGAGCATCTCCGCAA
ATCTATGGCGCCGGCTCCATGATGGAACAGGAGCGCTACTGCGTCTACGACTCCAGCGCCTATTTTATCCAGGAC
CACCAGCACCGCCGCGAAGTGCTCATTTTTGGCGATGTTGAGCCGGATAGCATCTCGCTGCATCCGCGAAATTTA
GCCGTCTGGCAAGAAGCGGCGCCCAAGATTGCTGCTGGTCTGCTTACTGCCATTTTTATTGAATGCAGCTACGAC
GACTCTCAGAGCAACGACCGCTTGTTTGGTCATTTGAAACCCGTCTTTGTCATTCAGGAGCTGCATGTGCTGGCT
GCAGAAGTCGAGGCAGCTCGTGTTGCTGCTGTTGCTGCTGCCGCTGCTGCCGCCGCCGCCACAGCTGACTCGGGT
AGCGCCTCTGATACAGCATCGACGCGCAAACGCAAGCGCACCAGTTTAGGAGCTGGCAGTGGCGCGGAAAATAGA
CGCCCGTCGGTGCCTATTCGCAGGCAAAGCGCCGCAGCCACGGTGCACTTTCAGGACCCCTTTGCGCCCAAGCCT
CTTGGTCAGCCGTCTTGTCCGTCGCCCAACAAGCTGCCGTCGTTTGCCACGCCGCCTCCGCCACCTCCCCAGGCC
GCTCCAGGGGCAGCGGCGCCAGCCAATGGGACGGTGCAAGTCGCCACGCCAACAAAGGAAGACGAGGTGGCGCAT
GTGGAGCCTGCGGCTATTGAAACACCAGCCATGCGTCCGCTGCAGGGTCTCAAGGTGGTGATTATACACGTCAAG
GAAAAGCTGACGGACGAGGAGCCGGCAATTGGCGAGCGCATCATGGAGCAACTAAACGAACACGAACGGACGGCG
CAGCTTGGATGCGAGTTTGTCGTGTCGTATCCGGGACAGAGTTTCTATCTCTGA
Transcript >OphauB2|1360
ATGGGCCATGCCGACCACCATGACGCCCCCGTCTTGCACGTTGTTGTGCTGGGCGCTGGCGGCGGCCCTCAGGAA
TCCAACATAACCGCCATGCTGGTGCGCTCCGTCTCCCAGCACTGGGCCAAGGGTTCCGTTGTCGCCGTCGATGCC
GGCATCCACCTGTCCGCCATTGCCCGCTTGATAGGAGAATCGTCATCCCCGCGCTCTTCGCCTCAGTCGCAAGAC
GACGACGTGCCGCCCCGATTAGCCCACGGGCCTTTGCAAGGCTTGCCATTGCCTTGCCGCTCCGTCGAGGCCAAT
GCAGCCCACGTTGTGCGCACGCTTGTCGACACCTATCTCATTACCCATCCTCACCTCGACCACATCTCGGGCCTC
GTGGTCAACACAGCTGGCCTGTCGGCCTCGCGTCCCAAGAAGATTGCCGGCCTGCCCTCTACCATTCAAGCACTC
AAGAACCACATCTTCAACAACATCATTTGGCCTAATCTTAGCGACGAGAACAACGGCGCCGGCCTGTTGACGTAT
CTGCGTCTTGTCGAGGGCGGCAGTCCGGCTCTCGGCCATGGCTCTAGCAGGGGCTACGTCGAAGTATGTGACGGC
TTGCTCGTCAAGGCCTGGAGCGTCAGCCACGGCCACTGCATCGAGCGACATGCCCATCGTGGCTCTGCCTCGGCT
GCCTCGGCCTCGTTTTCCTGTCCATCGCCGCGCTACGGCAGCCACGATGGGTCTGCTGCCACTCAGCCCCAGCCG
CCTCATGGGCGTGCCTCGATGCTCGGGAGTGGAGCTGCCACTGGTGCGTCGGGTGCTGGCGGAGCATCTCCGCAA
ATCTATGGCGCCGGCTCCATGATGGAACAGGAGCGCTACTGCGTCTACGACTCCAGCGCCTATTTTATCCAGGAC
CACCAGCACCGCCGCGAAGTGCTCATTTTTGGCGATGTTGAGCCGGATAGCATCTCGCTGCATCCGCGAAATTTA
GCCGTCTGGCAAGAAGCGGCGCCCAAGATTGCTGCTGGTCTGCTTACTGCCATTTTTATTGAATGCAGCTACGAC
GACTCTCAGAGCAACGACCGCTTGTTTGGTCATTTGAAACCCGTCTTTGTCATTCAGGAGCTGCATGTGCTGGCT
GCAGAAGTCGAGGCAGCTCGTGTTGCTGCTGTTGCTGCTGCCGCTGCTGCCGCCGCCGCCACAGCTGACTCGGGT
AGCGCCTCTGATACAGCATCGACGCGCAAACGCAAGCGCACCAGTTTAGGAGCTGGCAGTGGCGCGGAAAATAGA
CGCCCGTCGGTGCCTATTCGCAGGCAAAGCGCCGCAGCCACGGTGCACTTTCAGGACCCCTTTGCGCCCAAGCCT
CTTGGTCAGCCGTCTTGTCCGTCGCCCAACAAGCTGCCGTCGTTTGCCACGCCGCCTCCGCCACCTCCCCAGGCC
GCTCCAGGGGCAGCGGCGCCAGCCAATGGGACGGTGCAAGTCGCCACGCCAACAAAGGAAGACGAGGTGGCGCAT
GTGGAGCCTGCGGCTATTGAAACACCAGCCATGCGTCCGCTGCAGGGTCTCAAGGTGGTGATTATACACGTCAAG
GAAAAGCTGACGGACGAGGAGCCGGCAATTGGCGAGCGCATCATGGAGCAACTAAACGAACACGAACGGACGGCG
CAGCTTGGATGCGAGTTTGTCGTGTCGTATCCGGGACAGAGTTTCTATCTCTGA
Gene >OphauB2|1360
ATGGGCCATGCCGACCACCATGACGCCCCCGTCTTGCACGTTGTTGTGCTGGTGAGTAGCCTGCTGCTTTTTGCC
TGCCTTGGAGGCCTGCCTTGACGGCCTGCCTTGACCGTCTGCCTCTTGTTGCCTCTTGGCTAACGAGCTTGTCTT
TAGGGCGCTGGCGGCGGCCCTCAGGAATCCAACATAACCGCCATGCTGGTGCGCTCCGTCTCCCAGCACTGGGCC
AAGGGTTCCGTTGTCGCCGTCGATGCCGGCATCCACCTGTCCGCCATTGCCCGCTTGATAGGAGAATCGTCATCC
CCGCGCTCTTCGCCTCAGTCGCAAGACGACGACGTGCCGCCCCGATTAGCCCACGGGCCTTTGCAAGGCTTGCCA
TTGCCTTGCCGCTCCGTCGAGGCCAATGCAGCCCACGTTGTGCGCACGCTTGTCGACACCTATCTCATTACCCAT
CCTCACCTCGACCACATCTCGGGCCTCGTGGTCAACACAGCTGGCCTGTCGGCCTCGCGTCCCAAGAAGATTGCC
GGCCTGCCCTCTACCATTCAAGCACTCAAGAACCACATCTTCAACAACATCATTTGGCCTAATCTTAGCGACGAG
AACAACGGCGCCGGCCTGTTGACGTATCTGCGTCTTGTCGAGGGCGGCAGTCCGGCTCTCGGCCATGGCTCTAGC
AGGGGCTACGTCGAAGTATGTGACGGCTTGCTCGTCAAGGCCTGGAGCGTCAGCCACGGCCACTGCATCGAGCGA
CATGCCCATCGTGGCTCTGCCTCGGCTGCCTCGGCCTCGTTTTCCTGTCCATCGCCGCGCTACGGCAGCCACGAT
GGGTCTGCTGCCACTCAGCCCCAGCCGCCTCATGGGCGTGCCTCGATGCTCGGGAGTGGAGCTGCCACTGGTGCG
TCGGGTGCTGGCGGAGCATCTCCGCAAATCTATGGCGCCGGCTCCATGATGGAACAGGAGCGCTACTGCGTCTAC
GACTCCAGCGCCTATTTTATCCAGGACCACCAGCACCGCCGCGAAGTGCTCATTTTTGGCGATGTTGAGCCGGAT
AGCATCTCGCTGCATCCGCGAAATTTAGCCGTCTGGCAAGAAGCGGCGCCCAAGATTGCTGCTGGTCTGCTTACT
GCCATTTTTATTGAATGCAGCTACGACGACTCTCAGAGCAACGACCGCTTGTTTGGTCATTTGAAACCCGTCTTT
GTCATTCAGGAGCTGCATGTGCTGGCTGCAGAAGTCGAGGCAGCTCGTGTTGCTGCTGTTGCTGCTGCCGCTGCT
GCCGCCGCCGCCACAGCTGACTCGGGTAGCGCCTCTGATACAGCATCGACGCGCAAACGCAAGCGCACCAGTTTA
GGAGCTGGCAGTGGCGCGGAAAATAGACGCCCGTCGGTGCCTATTCGCAGGCAAAGCGCCGCAGCCACGGTGCAC
TTTCAGGACCCCTTTGCGCCCAAGCCTCTTGGTCAGCCGTCTTGTCCGTCGCCCAACAAGCTGCCGTCGTTTGCC
ACGCCGCCTCCGCCACCTCCCCAGGCCGCTCCAGGGGCAGCGGCGCCAGCCAATGGGACGGTGCAAGTCGCCACG
CCAACAAAGGAAGACGAGGTGGCGCATGTGGAGCCTGCGGCTATTGAAACACCAGCCATGCGTCCGCTGCAGGGT
CTCAAGGTGGTGATTATACACGTCAAGGAAAAGCTGACGGACGAGGAGCCGGCAATTGGCGAGCGCATCATGGAG
CAACTAAACGAACACGAACGGACGGCGCAGCTTGGATGCGAGTTTGTCGTGTCGTATCCGGGACAGAGTTTCTAT
CTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail