Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1359
Gene name
LocationContig_134:30680..31666
Strand+
Gene length (bp)986
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01613 Flavin_Reduct Flavin reductase like domain 3.7E-15 81 231

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O67071|Y928_AQUAE Uncharacterized protein aq_928 OS=Aquifex aeolicus (strain VF5) GN=aq_928 PE=3 SV=1 73 256 4.0E-25
sp|Q9KAK9|Y2278_BACHD Uncharacterized protein BH2278 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH2278 PE=3 SV=1 72 270 2.0E-24
sp|O05220|YWRF_BACSU Uncharacterized protein YwrF OS=Bacillus subtilis (strain 168) GN=ywrF PE=3 SV=1 73 266 2.0E-24
sp|Q9RRA9|Y2585_DEIRA Uncharacterized protein DR_2585 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2585 PE=3 SV=2 68 270 3.0E-20
sp|O26255|P152_METTH Protein MTH_152 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_152 PE=1 SV=1 80 251 5.0E-09

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1359
MGDQNQRNPHPDFGKVQSERPPWDQASRFRYTQTVDTDWAFGDGPNRLAQHDADKTHVVIDPYAPNRPSVSNYKL
LISSIVPRPIAFISTRSADGSSTNLAPYSYFNVLNHDPPIFAVGFASSLAAAKDSLRNVAETREAVINIISEHFI
EAANSASIDSPYGDDEWATSGLTPDYSCQTVRCARVKEAVVSIEVKLDMLKEYKSRADEGRVTGTLAIFEGTRFW
VRQDALNPDQNLVDPAVLRPISRLGGITYARTTEAFELTRPKFKEELGGQDGFDKLKAQAPKHS*
Coding >OphauB2|1359
ATGGGAGACCAGAACCAGCGCAATCCCCACCCCGACTTTGGCAAGGTGCAAAGCGAGCGCCCGCCATGGGACCAA
GCCTCACGCTTCCGCTACACGCAAACCGTCGATACAGACTGGGCCTTTGGCGACGGCCCCAACCGCCTCGCCCAG
CACGACGCCGACAAGACACACGTCGTCATTGACCCCTACGCCCCCAACCGCCCCTCCGTCTCCAACTACAAGCTG
CTCATCTCCTCCATTGTCCCGCGCCCCATTGCCTTTATCAGCACCCGCAGCGCCGACGGCTCCTCCACCAACCTG
GCGCCCTATAGCTACTTCAACGTGCTCAACCACGATCCCCCCATTTTTGCCGTTGGCTTCGCCTCCTCCCTCGCC
GCCGCAAAGGACTCGCTGCGCAACGTGGCCGAGACGCGCGAGGCCGTCATCAACATTATTAGCGAGCACTTTATC
GAGGCGGCAAACTCGGCAAGCATCGACTCGCCCTATGGCGATGACGAGTGGGCCACGTCGGGCCTCACCCCAGAC
TACTCGTGCCAGACGGTGCGCTGTGCTCGCGTCAAGGAGGCTGTCGTGTCCATCGAGGTCAAGCTCGACATGCTA
AAGGAGTACAAGAGCAGGGCCGACGAGGGGCGCGTTACAGGCACCCTGGCCATTTTCGAGGGCACTCGCTTCTGG
GTGCGCCAGGATGCCCTCAATCCCGACCAGAACCTGGTTGATCCCGCCGTCCTGCGACCCATTAGCCGTCTGGGC
GGCATCACCTATGCTCGCACCACCGAGGCCTTTGAGCTGACGAGGCCCAAGTTCAAGGAGGAGCTGGGTGGCCAG
GACGGCTTTGATAAACTCAAGGCCCAAGCGCCTAAACACTCGTAA
Transcript >OphauB2|1359
ATGGGAGACCAGAACCAGCGCAATCCCCACCCCGACTTTGGCAAGGTGCAAAGCGAGCGCCCGCCATGGGACCAA
GCCTCACGCTTCCGCTACACGCAAACCGTCGATACAGACTGGGCCTTTGGCGACGGCCCCAACCGCCTCGCCCAG
CACGACGCCGACAAGACACACGTCGTCATTGACCCCTACGCCCCCAACCGCCCCTCCGTCTCCAACTACAAGCTG
CTCATCTCCTCCATTGTCCCGCGCCCCATTGCCTTTATCAGCACCCGCAGCGCCGACGGCTCCTCCACCAACCTG
GCGCCCTATAGCTACTTCAACGTGCTCAACCACGATCCCCCCATTTTTGCCGTTGGCTTCGCCTCCTCCCTCGCC
GCCGCAAAGGACTCGCTGCGCAACGTGGCCGAGACGCGCGAGGCCGTCATCAACATTATTAGCGAGCACTTTATC
GAGGCGGCAAACTCGGCAAGCATCGACTCGCCCTATGGCGATGACGAGTGGGCCACGTCGGGCCTCACCCCAGAC
TACTCGTGCCAGACGGTGCGCTGTGCTCGCGTCAAGGAGGCTGTCGTGTCCATCGAGGTCAAGCTCGACATGCTA
AAGGAGTACAAGAGCAGGGCCGACGAGGGGCGCGTTACAGGCACCCTGGCCATTTTCGAGGGCACTCGCTTCTGG
GTGCGCCAGGATGCCCTCAATCCCGACCAGAACCTGGTTGATCCCGCCGTCCTGCGACCCATTAGCCGTCTGGGC
GGCATCACCTATGCTCGCACCACCGAGGCCTTTGAGCTGACGAGGCCCAAGTTCAAGGAGGAGCTGGGTGGCCAG
GACGGCTTTGATAAACTCAAGGCCCAAGCGCCTAAACACTCGTAA
Gene >OphauB2|1359
ATGGGAGACCAGAACCAGCGCAATCCCCACCCCGACTTTGGCAAGGTGCAAAGCGAGCGCCCGCCATGGGACCAA
GCCTCACGCTTCCGCTACACGCAAACCGTCGATACAGACTGGGCCTTTGGCGACGGCCCCAACCGCCTCGCCCAG
CACGACGCCGACAAGACACACGTCGTCATTGACCCCTACGCCCCCAACCGCCCCTCCGTCTCCAACTACAAGCTG
CTCATCTCCTCCATTGTCCCGCGCCCCATTGCCTTTATCAGCACCCGCAGCGCCGACGGCTCCTCCACCAACCTG
GCGCCCTATAGCTACTTCAACGTGCTCAACCACGATCCCCCCATTTTTGCCGTTGGCTTCGCCTCCTCCCTCGCC
GCCGCAAAGGACTCGCTGCGCAACGTGGCCGAGACGCGCGAGGCCGTCATCAACATTATTAGCGAGCACTTTATC
GAGGCGGCAAACTCGGCAAGCATCGACTCGCCCTATGGCGATGACGAGTGGGCCACGTCGGGCCTCACCCCAGAC
TACTCGTGCCAGACGGTGCGCTGTGCTCGCGTCAAGGAGGCTGTCGTGTCCATCGAGGTCAAGCTCGACATGCTA
AAGGAGTACAAGAGCAGGGCCGACGAGGGGCGCGTTACAGGCACCCTGGCCATTTTCGAGGGCACTCGCTTCTGG
GTGCGCCAGGATGCCCTCAATCCCGACCAGAACCTGGTTGATCCCGCCGTGAGTTTTCACTCTTGATTTCTCTCT
CTATCCCCGCCGATGTCTCTCTTCTTTTTTTTTGTTCCCCTTCTTCCTTTGCCTCGCACGCTGACTTTTTTTTTT
TTTGCTTGGCCTAGGTCCTGCGACCCATTAGCCGTCTGGGCGGCATCACCTATGCTCGCACCACCGAGGCCTTTG
AGCTGACGAGGCCCAAGTTCAAGGAGGAGCTGGGTGGCCAGGACGGCTTTGATAAACTCAAGGCCCAAGCGCCTA
AACACTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail