Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1358
Gene name
LocationContig_134:27194..30029
Strand-
Gene length (bp)2835
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13691 Lactamase_B_4 tRNase Z endonuclease 9.5E-19 45 106
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 7.1E-07 617 670
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 2.4E-06 791 859
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 4.3E-06 603 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10155|RNZ1_SCHPO Ribonuclease Z 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trz1 PE=3 SV=1 349 865 8.0E-57
sp|P36159|RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRZ1 PE=1 SV=1 346 872 8.0E-54
sp|Q9GL72|RNZ2_PANTR Zinc phosphodiesterase ELAC protein 2 OS=Pan troglodytes GN=ELAC2 PE=2 SV=1 270 937 2.0E-40
sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2 270 866 4.0E-39
sp|Q9GL73|RNZ2_GORGO Zinc phosphodiesterase ELAC protein 2 OS=Gorilla gorilla gorilla GN=ELAC2 PE=2 SV=1 270 937 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10155|RNZ1_SCHPO Ribonuclease Z 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trz1 PE=3 SV=1 349 865 8.0E-57
sp|P36159|RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRZ1 PE=1 SV=1 346 872 8.0E-54
sp|Q9GL72|RNZ2_PANTR Zinc phosphodiesterase ELAC protein 2 OS=Pan troglodytes GN=ELAC2 PE=2 SV=1 270 937 2.0E-40
sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2 270 866 4.0E-39
sp|Q9GL73|RNZ2_GORGO Zinc phosphodiesterase ELAC protein 2 OS=Gorilla gorilla gorilla GN=ELAC2 PE=2 SV=1 270 937 1.0E-38
sp|Q8HY87|RNZ2_MACFA Zinc phosphodiesterase ELAC protein 2 OS=Macaca fascicularis GN=ELAC2 PE=2 SV=1 341 937 5.0E-37
sp|O44476|RNZ_CAEEL Ribonuclease Z OS=Caenorhabditis elegans GN=hoe-1 PE=2 SV=2 380 869 3.0E-35
sp|Q8CGS5|RNZ2_RAT Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus GN=Elac2 PE=1 SV=1 270 937 4.0E-35
sp|P87168|RNZ2_SCHPO Ribonuclease Z 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trz2 PE=3 SV=1 573 862 9.0E-27
sp|Q8TLK5|RNZ_METAC Ribonuclease Z OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rnz PE=3 SV=1 589 864 3.0E-20
sp|Q8Q032|RNZ_METMA Ribonuclease Z OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rnz PE=3 SV=1 589 864 2.0E-18
sp|Q80Y81|RNZ2_MOUSE Zinc phosphodiesterase ELAC protein 2 OS=Mus musculus GN=Elac2 PE=1 SV=1 349 666 3.0E-18
sp|Q8MKW7|RNZ_DROME Ribonuclease Z, mitochondrial OS=Drosophila melanogaster GN=JhI-1 PE=1 SV=2 588 667 7.0E-16
sp|A6UUY8|RNZ_META3 Ribonuclease Z OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rnz PE=3 SV=1 588 863 9.0E-16
sp|Q3AHP8|RNZ_SYNSC Ribonuclease Z OS=Synechococcus sp. (strain CC9605) GN=rnz PE=3 SV=1 588 864 1.0E-14
sp|A6UN58|RNZ_METVS Ribonuclease Z OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rnz PE=3 SV=1 588 882 1.0E-14
sp|Q3AZH7|RNZ_SYNS9 Ribonuclease Z OS=Synechococcus sp. (strain CC9902) GN=rnz PE=3 SV=1 588 869 3.0E-14
sp|D4GZ88|RNZ_HALVD Ribonuclease Z OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rnz PE=1 SV=1 592 881 3.0E-14
sp|Q58897|RNZ_METJA Ribonuclease Z OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rnz PE=1 SV=2 588 865 9.0E-14
sp|Q5WGC3|RNZ_BACSK Ribonuclease Z OS=Bacillus clausii (strain KSM-K16) GN=rnz PE=3 SV=1 588 865 1.0E-13
sp|Q0I7X5|RNZ_SYNS3 Ribonuclease Z OS=Synechococcus sp. (strain CC9311) GN=rnz PE=3 SV=1 588 869 2.0E-13
sp|Q80Y81|RNZ2_MOUSE Zinc phosphodiesterase ELAC protein 2 OS=Mus musculus GN=Elac2 PE=1 SV=1 776 937 1.0E-12
sp|O58883|RNZ_PYRHO Ribonuclease Z OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnz PE=3 SV=1 588 864 2.0E-12
sp|A6VFJ7|RNZ_METM7 Ribonuclease Z OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rnz PE=3 SV=1 592 871 3.0E-12
sp|B7K1N1|RNZ_CYAP8 Ribonuclease Z OS=Cyanothece sp. (strain PCC 8801) GN=rnz PE=3 SV=1 588 870 4.0E-12
sp|A9AB37|RNZ_METM6 Ribonuclease Z OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rnz PE=3 SV=1 592 870 6.0E-12
sp|B1VY42|RNZ_STRGG Ribonuclease Z OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rnz PE=3 SV=1 588 881 7.0E-12
sp|Q3IRM5|RNZ_NATPD Ribonuclease Z OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rnz PE=3 SV=1 792 893 9.0E-12
sp|Q6LYT2|RNZ_METMP Ribonuclease Z OS=Methanococcus maripaludis (strain S2 / LL) GN=rnz PE=3 SV=1 588 872 9.0E-12
sp|Q82BX8|RNZ_STRAW Ribonuclease Z OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rnz PE=3 SV=1 588 872 1.0E-11
sp|Q8MKW7|RNZ_DROME Ribonuclease Z, mitochondrial OS=Drosophila melanogaster GN=JhI-1 PE=1 SV=2 768 881 2.0E-11
sp|C5A5S2|RNZ_THEGJ Ribonuclease Z OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rnz PE=3 SV=1 588 864 2.0E-11
sp|B7NNU8|RBN_ECO7I Ribonuclease BN OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|P0A8V1|RBN_SHIFL Ribonuclease BN OS=Shigella flexneri GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|B6I7L2|RBN_ECOSE Ribonuclease BN OS=Escherichia coli (strain SE11) GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|P0A8V0|RBN_ECOLI Ribonuclease BN OS=Escherichia coli (strain K12) GN=rbn PE=1 SV=1 588 863 2.0E-11
sp|B1IXR8|RBN_ECOLC Ribonuclease BN OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|A8A2D6|RBN_ECOHS Ribonuclease BN OS=Escherichia coli O9:H4 (strain HS) GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|C4ZUB1|RBN_ECOBW Ribonuclease BN OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rbn PE=3 SV=1 588 863 2.0E-11
sp|Q8XCZ0|RBN_ECO57 Ribonuclease BN OS=Escherichia coli O157:H7 GN=rbn PE=3 SV=2 588 863 3.0E-11
sp|B2TW54|RBN_SHIB3 Ribonuclease BN OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rbn PE=3 SV=1 588 863 3.0E-11
sp|B1J6H3|RNZ_PSEPW Ribonuclease Z OS=Pseudomonas putida (strain W619) GN=rnz PE=3 SV=1 588 863 4.0E-11
sp|Q1R9E5|RBN_ECOUT Ribonuclease BN OS=Escherichia coli (strain UTI89 / UPEC) GN=rbn PE=3 SV=1 588 863 5.0E-11
sp|Q8FFK8|RBN_ECOL6 Ribonuclease BN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rbn PE=3 SV=1 588 863 5.0E-11
sp|A1ADC0|RBN_ECOK1 Ribonuclease BN OS=Escherichia coli O1:K1 / APEC GN=rbn PE=3 SV=1 588 863 5.0E-11
sp|B7MG36|RBN_ECO45 Ribonuclease BN OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rbn PE=3 SV=1 588 863 5.0E-11
sp|Q0TFH3|RBN_ECOL5 Ribonuclease BN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rbn PE=3 SV=1 588 863 5.0E-11
sp|B7M5V1|RBN_ECO8A Ribonuclease BN OS=Escherichia coli O8 (strain IAI1) GN=rbn PE=3 SV=1 588 863 6.0E-11
sp|B7LAT4|RBN_ECO55 Ribonuclease BN OS=Escherichia coli (strain 55989 / EAEC) GN=rbn PE=3 SV=1 588 863 6.0E-11
sp|A7ZP87|RBN_ECO24 Ribonuclease BN OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rbn PE=3 SV=1 588 863 6.0E-11
sp|Q9RDE4|RNZ_STRCO Ribonuclease Z OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rnz PE=3 SV=1 588 872 7.0E-11
sp|B7UFT1|RBN_ECO27 Ribonuclease BN OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rbn PE=3 SV=1 588 863 7.0E-11
sp|B7MXV1|RBN_ECO81 Ribonuclease BN OS=Escherichia coli O81 (strain ED1a) GN=rbn PE=3 SV=1 588 863 7.0E-11
sp|B6IRV8|RNZ_RHOCS Ribonuclease Z OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rnz PE=3 SV=1 588 875 2.0E-10
sp|Q1IA50|RNZ_PSEE4 Ribonuclease Z OS=Pseudomonas entomophila (strain L48) GN=rnz PE=3 SV=1 592 661 1.0E-09
sp|O29323|RNZ_ARCFU Ribonuclease Z OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rnz PE=3 SV=1 792 868 3.0E-09
sp|O27859|RNZ_METTH Ribonuclease Z OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnz PE=3 SV=1 588 669 7.0E-09
sp|B6YT50|RNZ_THEON Ribonuclease Z OS=Thermococcus onnurineus (strain NA1) GN=rnz PE=3 SV=1 588 671 1.0E-08
sp|Q1DEJ2|RNZ_MYXXD Ribonuclease Z OS=Myxococcus xanthus (strain DK 1622) GN=rnz PE=3 SV=1 792 863 1.0E-08
sp|O27859|RNZ_METTH Ribonuclease Z OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rnz PE=3 SV=1 792 871 2.0E-08
sp|A5W1E8|RNZ_PSEP1 Ribonuclease Z OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnz PE=3 SV=1 588 661 2.0E-08
sp|Q88FQ4|RNZ_PSEPK Ribonuclease Z OS=Pseudomonas putida (strain KT2440) GN=rnz PE=3 SV=1 588 661 3.0E-08
sp|B0KMS1|RNZ_PSEPG Ribonuclease Z OS=Pseudomonas putida (strain GB-1) GN=rnz PE=3 SV=1 588 661 3.0E-08
sp|A4FXT9|RNZ_METM5 Ribonuclease Z OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rnz PE=3 SV=1 792 871 3.0E-08
sp|A4YHP1|RNZ_METS5 Ribonuclease Z OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rnz PE=3 SV=1 792 875 4.0E-08
sp|C6A2P3|RNZ_THESM Ribonuclease Z OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnz PE=3 SV=1 588 671 4.0E-08
sp|B0CE23|RNZ_ACAM1 Ribonuclease Z OS=Acaryochloris marina (strain MBIC 11017) GN=rnz PE=3 SV=1 588 666 8.0E-08
sp|A2C725|RNZ_PROM3 Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9303) GN=rnz PE=3 SV=1 588 661 9.0E-08
sp|Q7V5W1|RNZ_PROMM Ribonuclease Z OS=Prochlorococcus marinus (strain MIT 9313) GN=rnz PE=3 SV=2 588 661 9.0E-08
sp|Q5JE70|RNZ_THEKO Ribonuclease Z OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnz PE=3 SV=1 588 671 9.0E-08
sp|A5GN87|RNZ_SYNPW Ribonuclease Z OS=Synechococcus sp. (strain WH7803) GN=rnz PE=3 SV=1 588 661 1.0E-07
sp|B0JGG3|RNZ_MICAN Ribonuclease Z OS=Microcystis aeruginosa (strain NIES-843) GN=rnz PE=3 SV=1 588 666 2.0E-07
sp|C0ZBP8|RNZ_BREBN Ribonuclease Z OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rnz PE=3 SV=1 589 675 2.0E-07
sp|Q7U8S4|RNZ_SYNPX Ribonuclease Z OS=Synechococcus sp. (strain WH8102) GN=rnz PE=3 SV=1 588 661 3.0E-07
sp|Q9UZP4|RNZ_PYRAB Ribonuclease Z OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnz PE=3 SV=1 588 671 3.0E-07
sp|Q92A38|RNZ_LISIN Ribonuclease Z OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rnz PE=3 SV=1 588 661 3.0E-07
sp|B1XN66|RNZ_SYNP2 Ribonuclease Z OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rnz PE=3 SV=1 588 666 3.0E-07
sp|B7K762|RNZ_CYAP7 Ribonuclease Z OS=Cyanothece sp. (strain PCC 7424) GN=rnz PE=3 SV=1 588 666 4.0E-07
sp|B9LQT0|RNZ_HALLT Ribonuclease Z OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rnz PE=3 SV=1 792 893 4.0E-07
sp|A8ADW5|RBN_CITK8 Ribonuclease BN OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rbn PE=3 SV=1 588 661 6.0E-07
sp|Q5UZJ9|RNZ_HALMA Ribonuclease Z OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rnz PE=3 SV=1 792 881 6.0E-07
sp|B1WQW1|RNZ_CYAA5 Ribonuclease Z OS=Cyanothece sp. (strain ATCC 51142) GN=rnz PE=3 SV=1 588 666 7.0E-07
sp|B2J3C7|RNZ_NOSP7 Ribonuclease Z OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rnz PE=3 SV=1 588 666 7.0E-07
sp|C0Q055|RBN_SALPC Ribonuclease BN OS=Salmonella paratyphi C (strain RKS4594) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|P60195|RBN_SALTY Ribonuclease BN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|P60194|RBN_SALTI Ribonuclease BN OS=Salmonella typhi GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|B5BCN2|RBN_SALPK Ribonuclease BN OS=Salmonella paratyphi A (strain AKU_12601) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|A9N598|RBN_SALPB Ribonuclease BN OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|Q5PN69|RBN_SALPA Ribonuclease BN OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|B4TBI0|RBN_SALHS Ribonuclease BN OS=Salmonella heidelberg (strain SL476) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|B5RCD8|RBN_SALG2 Ribonuclease BN OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|B5R2Z4|RBN_SALEP Ribonuclease BN OS=Salmonella enteritidis PT4 (strain P125109) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|B5FPF2|RBN_SALDC Ribonuclease BN OS=Salmonella dublin (strain CT_02021853) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|Q57M43|RBN_SALCH Ribonuclease BN OS=Salmonella choleraesuis (strain SC-B67) GN=rbn PE=3 SV=2 588 661 8.0E-07
sp|B5EZJ2|RBN_SALA4 Ribonuclease BN OS=Salmonella agona (strain SL483) GN=rbn PE=3 SV=1 588 661 8.0E-07
sp|Q55132|RNZ_SYNY3 Ribonuclease Z OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rnz PE=3 SV=1 588 666 8.0E-07
sp|C0ZBP8|RNZ_BREBN Ribonuclease Z OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rnz PE=3 SV=1 792 895 9.0E-07
sp|Q8EQ58|RNZ_OCEIH Ribonuclease Z OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rnz PE=3 SV=1 588 661 9.0E-07
sp|Q4J9A4|RNZ_SULAC Ribonuclease Z OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rnz PE=3 SV=1 787 875 9.0E-07
sp|Q8DKE4|RNZ_THEEB Ribonuclease Z OS=Thermosynechococcus elongatus (strain BP-1) GN=rnz PE=3 SV=1 588 666 1.0E-06
sp|Q7VAN0|RNZ_PROMA Ribonuclease Z OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnz PE=3 SV=1 588 661 1.0E-06
sp|C3MPH2|RNZ_SULIL Ribonuclease Z OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rnz PE=3 SV=1 792 863 1.0E-06
sp|Q97Z88|RNZ_SULSO Ribonuclease Z OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rnz PE=3 SV=1 588 668 1.0E-06
sp|A7GSG2|RNZ_BACCN Ribonuclease Z OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rnz PE=3 SV=1 588 661 1.0E-06
sp|Q5KXG8|RNZ_GEOKA Ribonuclease Z OS=Geobacillus kaustophilus (strain HTA426) GN=rnz PE=3 SV=1 588 661 2.0E-06
sp|B9KYQ3|RNZ_THERP Ribonuclease Z OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rnz PE=3 SV=1 587 676 2.0E-06
sp|Q8U182|RNZ_PYRFU Ribonuclease Z OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnz PE=1 SV=1 588 671 2.0E-06
sp|C1AAD9|RNZ_GEMAT Ribonuclease Z OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rnz PE=3 SV=1 792 876 2.0E-06
sp|Q118J2|RNZ_TRIEI Ribonuclease Z OS=Trichodesmium erythraeum (strain IMS101) GN=rnz PE=3 SV=1 588 666 2.0E-06
sp|B8HP81|RNZ_CYAP4 Ribonuclease Z OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rnz PE=3 SV=1 588 666 2.0E-06
sp|Q9HN60|RNZ_HALSA Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rnz PE=3 SV=1 792 868 2.0E-06
sp|B0R7E2|RNZ_HALS3 Ribonuclease Z OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rnz PE=3 SV=1 792 868 2.0E-06
sp|A7Z6F0|RNZ_BACMF Ribonuclease Z OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rnz PE=3 SV=1 792 876 4.0E-06
sp|B4EUI8|RBN_PROMH Ribonuclease BN OS=Proteus mirabilis (strain HI4320) GN=rbn PE=3 SV=1 790 864 4.0E-06
sp|Q29RY4|RNZ1_BOVIN Zinc phosphodiesterase ELAC protein 1 OS=Bos taurus GN=ELAC1 PE=2 SV=1 790 918 4.0E-06
sp|C3NDQ2|RNZ_SULIY Ribonuclease Z OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rnz PE=3 SV=1 792 863 5.0E-06
sp|C3NHZ9|RNZ_SULIN Ribonuclease Z OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rnz PE=3 SV=1 792 863 5.0E-06
sp|Q8YLZ0|RNZ_NOSS1 Ribonuclease Z OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rnz PE=3 SV=1 588 666 5.0E-06
sp|P54548|RNZ_BACSU Ribonuclease Z OS=Bacillus subtilis (strain 168) GN=rnz PE=1 SV=1 792 873 5.0E-06
sp|Q9H777|RNZ1_HUMAN Zinc phosphodiesterase ELAC protein 1 OS=Homo sapiens GN=ELAC1 PE=1 SV=2 790 918 6.0E-06
sp|Q9KC61|RNZ_BACHD Ribonuclease Z OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rnz PE=3 SV=1 792 877 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008033 tRNA processing Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006399 tRNA metabolic process No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1358
MEKWGSRRFKPSWIVAGLKAFCRQHHHCTLPALQDTAQMATTVEIATTPSDDTPGTCLYVHHDRRTYIFGRVAEG
TQRAFGTRRLGLPNTSQIFLSGVVEWEQMGGILGYILTVGGAYEGAVEGRSHENKKRLKAGRRLLRPLKHGGLGL
HGGENLCHSLAACRHIIFRHSISLKVHEHRTDPRAEAPTQLEPDWSDESIRVWKIPVRKEAASSPPKRPHGAIDD
DDGAYKTGPALSDGEMASLIVERVMFSGSMESHKGKIIPCTVNDLRPGDAAFVLDKGTLQSYKGPYFSEEQGEPE
RGKESAWRFPRCESEAQESDEVAEDEEGVDALLVRRHSLPATRPSQTCMSYIVKCQGRRGKFDLAAAEALGVKNT
DFKYLTFGESVTGADGKTVTPDMVLGKAQAGRGIAVVDVPSTDWIDAFLQRPEWQQAELMEHVVAMYWIMGRGVA
SDERIQAFVQQHSQLRHVFCAPDTSPNMLTYTGAAQIQVKLRQIDAARFPLINFDNVVSQAAPGGDSPIELGRWG
AKVQLMPRLVFGEQAASFTNVAAAKLSSELRWLAREARDLAKSEATQARQRAANADLPNADAEVVALGTGSSMPS
KYRNVSATLVRVPGEGNYLLDCGEGTLGQMRRAFAPSELHQVLRDLRCIVISHMHADHHMGTISVVQAWHRATRN
DADADDKTLTISCIGRFRQMLHELGQVHDFGLRRVRFPNCEGIAAPFSPPSSPPSSPPSAPAPPPPPPSLSPLPP
QRDIDCVTAPSIPPYARLVSIKRIPVFHCQRAHAVQLHLVSGLRIAYSGDCRPSTLFADTCRGAHLLVHECTFDS
DRADHALTKRHSTLAEALGVAARMEARRVLLTHFSQRYTKAAALQQQQPRAADDSDEGGDKQAKDEGDKPQGDKE
ERVKQEQQVLLAYDMMRVVLGEYAEATCFVPVVQKLMEQMAATD*
Coding >OphauB2|1358
ATGGAGAAATGGGGCTCCCGCCGGTTCAAGCCATCGTGGATAGTTGCAGGTCTCAAGGCTTTTTGTCGCCAGCAT
CACCACTGTACACTACCGGCCTTGCAAGACACGGCACAAATGGCGACGACGGTGGAAATCGCCACGACGCCGTCG
GACGACACGCCCGGGACCTGTCTCTACGTGCACCATGACCGACGCACATACATCTTTGGGCGGGTGGCCGAGGGC
ACGCAGCGAGCGTTTGGCACACGCAGGCTGGGGCTGCCCAACACGAGCCAAATCTTTCTCTCTGGAGTTGTTGAG
TGGGAGCAAATGGGCGGCATCTTGGGCTACATCTTGACAGTTGGCGGTGCATATGAAGGGGCGGTTGAAGGGCGG
AGCCATGAGAATAAGAAGCGGCTCAAGGCGGGCCGGCGGCTGCTGCGGCCGCTGAAGCACGGCGGGCTGGGCCTG
CACGGCGGGGAGAACTTGTGCCACAGTCTTGCGGCCTGTCGCCACATCATCTTTCGGCACTCCATCAGCCTCAAG
GTGCACGAGCACCGGACGGATCCGCGGGCAGAGGCGCCGACGCAGCTGGAACCAGACTGGAGCGACGAGTCGATT
CGGGTGTGGAAGATTCCAGTGCGCAAAGAAGCGGCCAGCAGCCCCCCCAAGCGGCCACATGGCGCGATTGACGAC
GACGACGGGGCCTACAAGACGGGGCCGGCGCTGTCAGACGGCGAGATGGCGTCGCTCATTGTGGAGCGCGTCATG
TTTAGCGGCAGCATGGAAAGCCACAAGGGCAAAATCATTCCGTGCACGGTCAACGACTTGCGGCCAGGAGACGCG
GCGTTTGTGCTGGACAAGGGCACACTGCAGAGCTACAAGGGCCCGTATTTTTCGGAGGAGCAGGGCGAGCCAGAG
CGCGGCAAGGAGTCGGCGTGGCGGTTCCCGCGGTGCGAGAGCGAGGCGCAGGAGAGCGACGAGGTGGCCGAGGAC
GAGGAAGGGGTGGATGCTCTGCTTGTGCGGCGGCACTCGCTGCCGGCGACGCGGCCGTCGCAGACGTGCATGTCG
TACATTGTCAAGTGCCAGGGACGGCGGGGCAAGTTTGACTTGGCGGCGGCAGAGGCGCTGGGGGTCAAGAACACC
GACTTTAAATACCTGACGTTTGGGGAGAGCGTGACGGGCGCCGACGGCAAGACGGTGACGCCCGACATGGTGCTG
GGCAAGGCGCAGGCTGGGCGGGGCATCGCGGTGGTGGATGTGCCGTCGACGGACTGGATCGACGCCTTTTTGCAG
CGGCCCGAGTGGCAGCAGGCGGAGCTCATGGAGCACGTGGTGGCCATGTACTGGATCATGGGCCGCGGGGTGGCG
AGCGACGAGCGCATCCAGGCCTTTGTGCAGCAGCACAGCCAGCTGCGACACGTGTTTTGCGCGCCCGACACGTCG
CCCAACATGCTGACGTACACGGGCGCGGCGCAGATTCAGGTCAAGCTGCGGCAAATCGACGCTGCGCGCTTCCCG
CTCATCAACTTTGACAATGTGGTGAGCCAGGCGGCGCCGGGAGGCGACTCGCCGATTGAGCTGGGCCGCTGGGGC
GCCAAGGTGCAGCTGATGCCGCGGCTCGTGTTTGGCGAGCAGGCGGCATCCTTTACCAATGTGGCGGCGGCCAAG
CTGAGCTCGGAGCTGCGATGGCTGGCACGGGAGGCGCGCGACTTGGCCAAGAGCGAGGCCACACAGGCGCGGCAG
CGGGCAGCCAATGCCGACCTGCCCAATGCCGATGCCGAGGTGGTTGCGCTGGGCACGGGGTCGTCGATGCCGAGC
AAGTACCGCAACGTGTCGGCGACGCTGGTGCGCGTGCCTGGCGAGGGCAACTATTTGCTCGACTGCGGCGAGGGC
ACGCTTGGCCAGATGCGGCGCGCCTTTGCCCCCAGCGAGCTGCACCAGGTGCTGCGCGACCTGCGGTGCATCGTC
ATAAGCCACATGCATGCCGACCACCACATGGGCACTATTTCTGTTGTGCAGGCCTGGCATCGTGCCACGCGCAAC
GACGCCGATGCCGACGACAAGACGCTCACCATTTCCTGCATTGGCCGCTTCCGCCAGATGCTGCATGAGCTGGGC
CAGGTGCACGACTTTGGCCTGCGCCGCGTGCGCTTTCCCAACTGCGAAGGCATTGCAGCACCATTCTCGCCTCCA
TCCTCGCCTCCATCCTCGCCTCCATCAGCACCAGCTCCTCCTCCTCCTCCTCCATCCCTCTCTCCCCTCCCCCCC
CAGCGCGACATTGACTGCGTCACCGCCCCCTCCATCCCCCCCTATGCCCGCCTCGTCTCCATCAAGCGCATCCCC
GTCTTCCACTGCCAGCGCGCCCACGCCGTGCAACTACACCTCGTCTCGGGCCTGCGCATCGCCTACTCTGGCGAC
TGCCGCCCCTCGACCCTCTTTGCCGACACGTGCCGCGGCGCCCACTTGCTAGTGCACGAATGCACCTTTGACTCG
GACCGCGCCGACCACGCCCTCACCAAGCGCCACTCGACCCTTGCAGAGGCGCTGGGCGTGGCGGCACGCATGGAG
GCGCGGCGCGTCTTGCTCACGCACTTTTCCCAGCGCTATACAAAGGCTGCCGCTCTGCAGCAGCAGCAGCCCAGG
GCCGCAGACGACTCGGACGAGGGGGGGGACAAGCAGGCCAAGGACGAGGGCGACAAGCCGCAAGGGGACAAGGAG
GAGAGGGTCAAGCAGGAGCAGCAGGTGCTCTTGGCGTATGACATGATGCGCGTAGTGCTGGGCGAGTATGCAGAG
GCCACGTGCTTTGTCCCCGTGGTGCAAAAGCTCATGGAGCAAATGGCTGCTACTGATTAG
Transcript >OphauB2|1358
ATGGAGAAATGGGGCTCCCGCCGGTTCAAGCCATCGTGGATAGTTGCAGGTCTCAAGGCTTTTTGTCGCCAGCAT
CACCACTGTACACTACCGGCCTTGCAAGACACGGCACAAATGGCGACGACGGTGGAAATCGCCACGACGCCGTCG
GACGACACGCCCGGGACCTGTCTCTACGTGCACCATGACCGACGCACATACATCTTTGGGCGGGTGGCCGAGGGC
ACGCAGCGAGCGTTTGGCACACGCAGGCTGGGGCTGCCCAACACGAGCCAAATCTTTCTCTCTGGAGTTGTTGAG
TGGGAGCAAATGGGCGGCATCTTGGGCTACATCTTGACAGTTGGCGGTGCATATGAAGGGGCGGTTGAAGGGCGG
AGCCATGAGAATAAGAAGCGGCTCAAGGCGGGCCGGCGGCTGCTGCGGCCGCTGAAGCACGGCGGGCTGGGCCTG
CACGGCGGGGAGAACTTGTGCCACAGTCTTGCGGCCTGTCGCCACATCATCTTTCGGCACTCCATCAGCCTCAAG
GTGCACGAGCACCGGACGGATCCGCGGGCAGAGGCGCCGACGCAGCTGGAACCAGACTGGAGCGACGAGTCGATT
CGGGTGTGGAAGATTCCAGTGCGCAAAGAAGCGGCCAGCAGCCCCCCCAAGCGGCCACATGGCGCGATTGACGAC
GACGACGGGGCCTACAAGACGGGGCCGGCGCTGTCAGACGGCGAGATGGCGTCGCTCATTGTGGAGCGCGTCATG
TTTAGCGGCAGCATGGAAAGCCACAAGGGCAAAATCATTCCGTGCACGGTCAACGACTTGCGGCCAGGAGACGCG
GCGTTTGTGCTGGACAAGGGCACACTGCAGAGCTACAAGGGCCCGTATTTTTCGGAGGAGCAGGGCGAGCCAGAG
CGCGGCAAGGAGTCGGCGTGGCGGTTCCCGCGGTGCGAGAGCGAGGCGCAGGAGAGCGACGAGGTGGCCGAGGAC
GAGGAAGGGGTGGATGCTCTGCTTGTGCGGCGGCACTCGCTGCCGGCGACGCGGCCGTCGCAGACGTGCATGTCG
TACATTGTCAAGTGCCAGGGACGGCGGGGCAAGTTTGACTTGGCGGCGGCAGAGGCGCTGGGGGTCAAGAACACC
GACTTTAAATACCTGACGTTTGGGGAGAGCGTGACGGGCGCCGACGGCAAGACGGTGACGCCCGACATGGTGCTG
GGCAAGGCGCAGGCTGGGCGGGGCATCGCGGTGGTGGATGTGCCGTCGACGGACTGGATCGACGCCTTTTTGCAG
CGGCCCGAGTGGCAGCAGGCGGAGCTCATGGAGCACGTGGTGGCCATGTACTGGATCATGGGCCGCGGGGTGGCG
AGCGACGAGCGCATCCAGGCCTTTGTGCAGCAGCACAGCCAGCTGCGACACGTGTTTTGCGCGCCCGACACGTCG
CCCAACATGCTGACGTACACGGGCGCGGCGCAGATTCAGGTCAAGCTGCGGCAAATCGACGCTGCGCGCTTCCCG
CTCATCAACTTTGACAATGTGGTGAGCCAGGCGGCGCCGGGAGGCGACTCGCCGATTGAGCTGGGCCGCTGGGGC
GCCAAGGTGCAGCTGATGCCGCGGCTCGTGTTTGGCGAGCAGGCGGCATCCTTTACCAATGTGGCGGCGGCCAAG
CTGAGCTCGGAGCTGCGATGGCTGGCACGGGAGGCGCGCGACTTGGCCAAGAGCGAGGCCACACAGGCGCGGCAG
CGGGCAGCCAATGCCGACCTGCCCAATGCCGATGCCGAGGTGGTTGCGCTGGGCACGGGGTCGTCGATGCCGAGC
AAGTACCGCAACGTGTCGGCGACGCTGGTGCGCGTGCCTGGCGAGGGCAACTATTTGCTCGACTGCGGCGAGGGC
ACGCTTGGCCAGATGCGGCGCGCCTTTGCCCCCAGCGAGCTGCACCAGGTGCTGCGCGACCTGCGGTGCATCGTC
ATAAGCCACATGCATGCCGACCACCACATGGGCACTATTTCTGTTGTGCAGGCCTGGCATCGTGCCACGCGCAAC
GACGCCGATGCCGACGACAAGACGCTCACCATTTCCTGCATTGGCCGCTTCCGCCAGATGCTGCATGAGCTGGGC
CAGGTGCACGACTTTGGCCTGCGCCGCGTGCGCTTTCCCAACTGCGAAGGCATTGCAGCACCATTCTCGCCTCCA
TCCTCGCCTCCATCCTCGCCTCCATCAGCACCAGCTCCTCCTCCTCCTCCTCCATCCCTCTCTCCCCTCCCCCCC
CAGCGCGACATTGACTGCGTCACCGCCCCCTCCATCCCCCCCTATGCCCGCCTCGTCTCCATCAAGCGCATCCCC
GTCTTCCACTGCCAGCGCGCCCACGCCGTGCAACTACACCTCGTCTCGGGCCTGCGCATCGCCTACTCTGGCGAC
TGCCGCCCCTCGACCCTCTTTGCCGACACGTGCCGCGGCGCCCACTTGCTAGTGCACGAATGCACCTTTGACTCG
GACCGCGCCGACCACGCCCTCACCAAGCGCCACTCGACCCTTGCAGAGGCGCTGGGCGTGGCGGCACGCATGGAG
GCGCGGCGCGTCTTGCTCACGCACTTTTCCCAGCGCTATACAAAGGCTGCCGCTCTGCAGCAGCAGCAGCCCAGG
GCCGCAGACGACTCGGACGAGGGGGGGGACAAGCAGGCCAAGGACGAGGGCGACAAGCCGCAAGGGGACAAGGAG
GAGAGGGTCAAGCAGGAGCAGCAGGTGCTCTTGGCGTATGACATGATGCGCGTAGTGCTGGGCGAGTATGCAGAG
GCCACGTGCTTTGTCCCCGTGGTGCAAAAGCTCATGGAGCAAATGGCTGCTACTGATTAG
Gene >OphauB2|1358
ATGGAGAAATGGGGCTCCCGCCGGTTCAAGCCATCGTGGATAGTTGCAGGTCTCAAGGCTTTTTGTCGCCAGCAT
CACCACTGTACACTACCGGCCTTGCAAGACACGGCACAAATGGCGACGACGGTGGAAATCGCCACGACGCCGTCG
GACGACACGCCCGGGACCTGTCTCTACGTGCACCATGACCGACGCACATACATCTTTGGGCGGGTGGCCGAGGGC
ACGCAGCGAGCGTTTGGCACACGCAGGCTGGGGCTGCCCAACACGAGCCAAATCTTTCTCTCTGGAGTTGTTGAG
TGGGAGCAAATGGGCGGCATCTTGGGCTACATCTTGACAGTTGGCGGTGCATATGAAGGGGCGGTTGAAGGGCGG
AGCCATGAGAATAAGAAGCGGCTCAAGGCGGGCCGGCGGCTGCTGCGGCCGCTGAAGCACGGCGGGCTGGGCCTG
CACGGCGGGGAGAACTTGTGCCACAGTCTTGCGGCCTGTCGCCACATCATCTTTCGGCACTCCATCAGCCTCAAG
GTGCACGAGCACCGGACGGATCCGCGGGCAGAGGCGCCGACGCAGCTGGAACCAGACTGGAGCGACGAGTCGATT
CGGGTGTGGAAGATTCCAGTGCGCAAAGAAGCGGCCAGCAGCCCCCCCAAGCGGCCACATGGCGCGATTGACGAC
GACGACGGGGCCTACAAGACGGGGCCGGCGCTGTCAGACGGCGAGATGGCGTCGCTCATTGTGGAGCGCGTCATG
TTTAGCGGCAGCATGGAAAGCCACAAGGGCAAAATCATTCCGTGCACGGTCAACGACTTGCGGCCAGGAGACGCG
GCGTTTGTGCTGGACAAGGGCACACTGCAGAGCTACAAGGGCCCGTATTTTTCGGAGGAGCAGGGCGAGCCAGAG
CGCGGCAAGGAGTCGGCGTGGCGGTTCCCGCGGTGCGAGAGCGAGGCGCAGGAGAGCGACGAGGTGGCCGAGGAC
GAGGAAGGGGTGGATGCTCTGCTTGTGCGGCGGCACTCGCTGCCGGCGACGCGGCCGTCGCAGACGTGCATGTCG
TACATTGTCAAGTGCCAGGGACGGCGGGGCAAGTTTGACTTGGCGGCGGCAGAGGCGCTGGGGGTCAAGAACACC
GACTTTAAATACCTGACGTTTGGGGAGAGCGTGACGGGCGCCGACGGCAAGACGGTGACGCCCGACATGGTGCTG
GGCAAGGCGCAGGCTGGGCGGGGCATCGCGGTGGTGGATGTGCCGTCGACGGACTGGATCGACGCCTTTTTGCAG
CGGCCCGAGTGGCAGCAGGCGGAGCTCATGGAGCACGTGGTGGCCATGTACTGGATCATGGGCCGCGGGGTGGCG
AGCGACGAGCGCATCCAGGCCTTTGTGCAGCAGCACAGCCAGCTGCGACACGTGTTTTGCGCGCCCGACACGTCG
CCCAACATGCTGACGTACACGGGCGCGGCGCAGATTCAGGTCAAGCTGCGGCAAATCGACGCTGCGCGCTTCCCG
CTCATCAACTTTGACAATGTGGTGAGCCAGGCGGCGCCGGGAGGCGACTCGCCGATTGAGCTGGGCCGCTGGGGC
GCCAAGGTGCAGCTGATGCCGCGGCTCGTGTTTGGCGAGCAGGCGGCATCCTTTACCAATGTGGCGGCGGCCAAG
CTGAGCTCGGAGCTGCGATGGCTGGCACGGGAGGCGCGCGACTTGGCCAAGAGCGAGGCCACACAGGCGCGGCAG
CGGGCAGCCAATGCCGACCTGCCCAATGCCGATGCCGAGGTGGTTGCGCTGGGCACGGGGTCGTCGATGCCGAGC
AAGTACCGCAACGTGTCGGCGACGCTGGTGCGCGTGCCTGGCGAGGGCAACTATTTGCTCGACTGCGGCGAGGGC
ACGCTTGGCCAGATGCGGCGCGCCTTTGCCCCCAGCGAGCTGCACCAGGTGCTGCGCGACCTGCGGTGCATCGTC
ATAAGCCACATGCATGCCGACCACCACATGGGCACTATTTCTGTTGTGCAGGCCTGGCATCGTGCCACGCGCAAC
GACGCCGATGCCGACGACAAGACGCTCACCATTTCCTGCATTGGCCGCTTCCGCCAGATGCTGCATGAGCTGGGC
CAGGTGCACGACTTTGGCCTGCGCCGCGTGCGCTTTCCCAACTGCGAAGGCATTGCAGCACCATTCTCGCCTCCA
TCCTCGCCTCCATCCTCGCCTCCATCAGCACCAGCTCCTCCTCCTCCTCCTCCATCCCTCTCTCCCCTCCCCCCC
CAGCGCGACATTGACTGCGTCACCGCCCCCTCCATCCCCCCCTATGCCCGCCTCGTCTCCATCAAGCGCATCCCC
GTCTTCCACTGCCAGCGCGCCCACGCCGTGCAACTACACCTCGTCTCGGGCCTGCGCATCGCCTACTCTGGCGAC
TGCCGCCCCTCGACCCTCTTTGCCGACACGTGCCGCGGCGCCCACTTGCTAGTGCACGAATGCACCTTTGACTCG
GACCGCGCCGACCACGCCCTCACCAAGCGCCACTCGACCCTTGCAGAGGCGCTGGGCGTGGCGGCACGCATGGAG
GCGCGGCGCGTCTTGCTCACGCACTTTTCCCAGCGCTATACAAAGGCTGCCGCTCTGCAGCAGCAGCAGCCCAGG
GCCGCAGACGACTCGGACGAGGGGGGGGACAAGCAGGCCAAGGACGAGGGCGACAAGCCGCAAGGGGACAAGGAG
GAGAGGGTCAAGCAGGAGCAGCAGGTGCTCTTGGCGTATGACATGATGCGCGTAGTGCTGGGCGAGTATGCAGAG
GCCACGTGCTTTGTCCCCGTGGTGCAAAAGCTCATGGAGCAAATGGCTGCTACTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail