© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|1346 |
| Gene name | |
| Location | Contig_133:43447..44264 |
| Strand | - |
| Gene length (bp) | 817 |
| Transcript length (bp) | 498 |
| Coding sequence length (bp) | 498 |
| Protein length (aa) | 166 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF02823 | ATP-synt_DE_N | ATP synthase, Delta/Epsilon chain, beta-sandwich domain | 4.7E-16 | 36 | 108 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P56525|ATPD_NEUCR | ATP synthase subunit delta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=des PE=3 SV=2 | 1 | 165 | 1.0E-87 |
| sp|Q92196|ATPD_AGABI | ATP synthase subunit delta, mitochondrial OS=Agaricus bisporus GN=atpD PE=2 SV=1 | 1 | 160 | 5.0E-57 |
| sp|Q757N0|ATPD_ASHGO | ATP synthase subunit delta, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP16 PE=3 SV=1 | 1 | 165 | 7.0E-47 |
| sp|P78700|ATPD_KLULA | ATP synthase subunit delta, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP16 PE=3 SV=2 | 9 | 165 | 4.0E-43 |
| sp|Q12165|ATPD_YEAST | ATP synthase subunit delta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP16 PE=1 SV=1 | 35 | 165 | 3.0E-39 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P56525|ATPD_NEUCR | ATP synthase subunit delta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=des PE=3 SV=2 | 1 | 165 | 1.0E-87 |
| sp|Q92196|ATPD_AGABI | ATP synthase subunit delta, mitochondrial OS=Agaricus bisporus GN=atpD PE=2 SV=1 | 1 | 160 | 5.0E-57 |
| sp|Q757N0|ATPD_ASHGO | ATP synthase subunit delta, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP16 PE=3 SV=1 | 1 | 165 | 7.0E-47 |
| sp|P78700|ATPD_KLULA | ATP synthase subunit delta, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP16 PE=3 SV=2 | 9 | 165 | 4.0E-43 |
| sp|Q12165|ATPD_YEAST | ATP synthase subunit delta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP16 PE=1 SV=1 | 35 | 165 | 3.0E-39 |
| sp|Q9P6R6|ATPD_SCHPO | ATP synthase subunit delta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp16 PE=3 SV=2 | 25 | 160 | 1.0E-31 |
| sp|Q55F42|ATPD_DICDI | ATP synthase subunit delta, mitochondrial OS=Dictyostelium discoideum GN=atp5D PE=3 SV=1 | 26 | 161 | 5.0E-22 |
| sp|Q96252|ATP4_ARATH | ATP synthase subunit delta', mitochondrial OS=Arabidopsis thaliana GN=At5g47030 PE=1 SV=1 | 24 | 162 | 5.0E-21 |
| sp|Q40089|ATP4_IPOBA | ATP synthase subunit delta', mitochondrial OS=Ipomoea batatas PE=1 SV=1 | 21 | 162 | 6.0E-19 |
| sp|P05630|ATPD_BOVIN | ATP synthase subunit delta, mitochondrial OS=Bos taurus GN=ATP5D PE=1 SV=2 | 9 | 160 | 1.0E-17 |
| sp|Q9D3D9|ATPD_MOUSE | ATP synthase subunit delta, mitochondrial OS=Mus musculus GN=Atp5d PE=1 SV=1 | 9 | 160 | 2.0E-17 |
| sp|P35434|ATPD_RAT | ATP synthase subunit delta, mitochondrial OS=Rattus norvegicus GN=Atp5d PE=1 SV=2 | 9 | 160 | 4.0E-17 |
| sp|Q09544|ATPD_CAEEL | ATP synthase subunit delta, mitochondrial OS=Caenorhabditis elegans GN=F58F12.1 PE=1 SV=1 | 33 | 160 | 6.0E-17 |
| sp|Q41000|ATP4_PEA | ATP synthase subunit delta', mitochondrial OS=Pisum sativum PE=3 SV=1 | 18 | 162 | 8.0E-16 |
| sp|P30049|ATPD_HUMAN | ATP synthase subunit delta, mitochondrial OS=Homo sapiens GN=ATP5D PE=1 SV=2 | 9 | 160 | 2.0E-13 |
| sp|A7HT53|ATPE_PARL1 | ATP synthase epsilon chain OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpC PE=3 SV=1 | 33 | 151 | 3.0E-13 |
| sp|Q8UC77|ATPE_AGRFC | ATP synthase epsilon chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=atpC PE=3 SV=1 | 33 | 163 | 4.0E-11 |
| sp|B9JBZ4|ATPE_AGRRK | ATP synthase epsilon chain OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=atpC PE=3 SV=1 | 33 | 135 | 4.0E-11 |
| sp|Q2K3H1|ATPE_RHIEC | ATP synthase epsilon chain OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=atpC PE=3 SV=1 | 33 | 136 | 7.0E-11 |
| sp|A9HY45|ATPE_BORPD | ATP synthase epsilon chain OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=atpC PE=3 SV=1 | 55 | 154 | 8.0E-11 |
| sp|Q1MAZ3|ATPE_RHIL3 | ATP synthase epsilon chain OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=atpC PE=3 SV=1 | 33 | 136 | 2.0E-10 |
| sp|B3PQ67|ATPE_RHIE6 | ATP synthase epsilon chain OS=Rhizobium etli (strain CIAT 652) GN=atpC PE=3 SV=1 | 33 | 136 | 2.0E-10 |
| sp|Q63PI1|ATPE_BURPS | ATP synthase epsilon chain OS=Burkholderia pseudomallei (strain K96243) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|A3NF39|ATPE_BURP6 | ATP synthase epsilon chain OS=Burkholderia pseudomallei (strain 668) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|Q3JXW0|ATPE_BURP1 | ATP synthase epsilon chain OS=Burkholderia pseudomallei (strain 1710b) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|A3P0Y9|ATPE_BURP0 | ATP synthase epsilon chain OS=Burkholderia pseudomallei (strain 1106a) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|A1V8T0|ATPE_BURMS | ATP synthase epsilon chain OS=Burkholderia mallei (strain SAVP1) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|Q62FR4|ATPE_BURMA | ATP synthase epsilon chain OS=Burkholderia mallei (strain ATCC 23344) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|A2S6J7|ATPE_BURM9 | ATP synthase epsilon chain OS=Burkholderia mallei (strain NCTC 10229) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|A3MQK0|ATPE_BURM7 | ATP synthase epsilon chain OS=Burkholderia mallei (strain NCTC 10247) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-10 |
| sp|B5ZSN5|ATPE_RHILW | ATP synthase epsilon chain OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=atpC PE=3 SV=1 | 33 | 136 | 2.0E-10 |
| sp|Q2KU37|ATPE_BORA1 | ATP synthase epsilon chain OS=Bordetella avium (strain 197N) GN=atpC PE=3 SV=1 | 44 | 148 | 3.0E-10 |
| sp|Q39KX5|ATPE_BURL3 | ATP synthase epsilon chain OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=atpC PE=3 SV=1 | 35 | 154 | 4.0E-10 |
| sp|Q0BJL4|ATPE_BURCM | ATP synthase epsilon chain OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=atpC PE=3 SV=1 | 35 | 154 | 4.0E-10 |
| sp|B1YQL5|ATPE_BURA4 | ATP synthase epsilon chain OS=Burkholderia ambifaria (strain MC40-6) GN=atpC PE=3 SV=1 | 35 | 154 | 4.0E-10 |
| sp|Q1BRB1|ATPE1_BURCA | ATP synthase epsilon chain 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=atpC1 PE=3 SV=1 | 35 | 154 | 4.0E-10 |
| sp|A9AJG5|ATPE_BURM1 | ATP synthase epsilon chain OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=atpC PE=3 SV=1 | 35 | 154 | 5.0E-10 |
| sp|B2JJ94|ATPE_BURP8 | ATP synthase epsilon chain OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=atpC PE=3 SV=1 | 35 | 154 | 6.0E-10 |
| sp|B8EQQ2|ATPE_METSB | ATP synthase epsilon chain OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=atpC PE=3 SV=1 | 52 | 153 | 8.0E-10 |
| sp|Q92LK9|ATPE_RHIME | ATP synthase epsilon chain OS=Rhizobium meliloti (strain 1021) GN=atpC PE=3 SV=2 | 44 | 145 | 8.0E-10 |
| sp|A9BPU8|ATPE_DELAS | ATP synthase epsilon chain OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=atpC PE=3 SV=1 | 33 | 157 | 9.0E-10 |
| sp|Q13SQ3|ATPE1_BURXL | ATP synthase epsilon chain 1 OS=Burkholderia xenovorans (strain LB400) GN=atpC1 PE=3 SV=1 | 35 | 154 | 1.0E-09 |
| sp|Q0AKW2|ATPE_MARMM | ATP synthase epsilon chain OS=Maricaulis maris (strain MCS10) GN=atpC PE=3 SV=1 | 33 | 163 | 1.0E-09 |
| sp|B4EEZ0|ATPE_BURCJ | ATP synthase epsilon chain OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=atpC PE=3 SV=1 | 35 | 154 | 1.0E-09 |
| sp|Q2STF0|ATPE_BURTA | ATP synthase epsilon chain OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=atpC PE=3 SV=1 | 55 | 154 | 1.0E-09 |
| sp|Q7VU43|ATPE_BORPE | ATP synthase epsilon chain OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=atpC PE=3 SV=1 | 44 | 154 | 2.0E-09 |
| sp|Q7W3B1|ATPE_BORPA | ATP synthase epsilon chain OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=atpC PE=3 SV=1 | 44 | 154 | 2.0E-09 |
| sp|Q7WEN0|ATPE_BORBR | ATP synthase epsilon chain OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=atpC PE=3 SV=1 | 44 | 154 | 2.0E-09 |
| sp|B2T7J9|ATPE_BURPP | ATP synthase epsilon chain OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=atpC PE=3 SV=1 | 35 | 154 | 2.0E-09 |
| sp|B9JTR1|ATPE_AGRVS | ATP synthase epsilon chain OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=atpC PE=3 SV=1 | 33 | 135 | 3.0E-09 |
| sp|Q3IK29|ATPE_PSEHT | ATP synthase epsilon chain OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=atpC PE=3 SV=1 | 55 | 154 | 3.0E-09 |
| sp|P43718|ATPE_HAEIN | ATP synthase epsilon chain OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atpC PE=3 SV=1 | 51 | 156 | 4.0E-09 |
| sp|A5UGY8|ATPE_HAEIG | ATP synthase epsilon chain OS=Haemophilus influenzae (strain PittGG) GN=atpC PE=3 SV=1 | 51 | 156 | 4.0E-09 |
| sp|A5UA12|ATPE_HAEIE | ATP synthase epsilon chain OS=Haemophilus influenzae (strain PittEE) GN=atpC PE=3 SV=1 | 51 | 156 | 4.0E-09 |
| sp|Q4QN65|ATPE_HAEI8 | ATP synthase epsilon chain OS=Haemophilus influenzae (strain 86-028NP) GN=atpC PE=3 SV=1 | 51 | 156 | 4.0E-09 |
| sp|P05441|ATPE_RHOBL | ATP synthase epsilon chain OS=Rhodobacter blasticus GN=atpC PE=3 SV=1 | 53 | 149 | 4.0E-09 |
| sp|A6UDM0|ATPE_SINMW | ATP synthase epsilon chain OS=Sinorhizobium medicae (strain WSM419) GN=atpC PE=3 SV=1 | 44 | 145 | 5.0E-09 |
| sp|A5EXL3|ATPE_DICNV | ATP synthase epsilon chain OS=Dichelobacter nodosus (strain VCS1703A) GN=atpC PE=3 SV=1 | 42 | 104 | 6.0E-09 |
| sp|Q5H4Y3|ATPE_XANOR | ATP synthase epsilon chain OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=atpC PE=3 SV=1 | 60 | 165 | 8.0E-09 |
| sp|B2SQA9|ATPE_XANOP | ATP synthase epsilon chain OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=atpC PE=3 SV=1 | 60 | 165 | 8.0E-09 |
| sp|Q1QSD1|ATPE_CHRSD | ATP synthase epsilon chain OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=atpC PE=3 SV=1 | 54 | 120 | 8.0E-09 |
| sp|A8ACN5|ATPE_CITK8 | ATP synthase epsilon chain OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|A1RQA9|ATPE_SHESW | ATP synthase epsilon chain OS=Shewanella sp. (strain W3-18-1) GN=atpC PE=3 SV=1 | 35 | 164 | 1.0E-08 |
| sp|A4YCH7|ATPE_SHEPC | ATP synthase epsilon chain OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=atpC PE=3 SV=1 | 35 | 164 | 1.0E-08 |
| sp|B5XZM5|ATPE_KLEP3 | ATP synthase epsilon chain OS=Klebsiella pneumoniae (strain 342) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|P0A1B7|ATPE_SALTY | ATP synthase epsilon chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=atpC PE=2 SV=2 | 52 | 154 | 1.0E-08 |
| sp|P0A1B8|ATPE_SALTI | ATP synthase epsilon chain OS=Salmonella typhi GN=atpC PE=3 SV=2 | 52 | 154 | 1.0E-08 |
| sp|B5BIN5|ATPE_SALPK | ATP synthase epsilon chain OS=Salmonella paratyphi A (strain AKU_12601) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|C0Q2N1|ATPE_SALPC | ATP synthase epsilon chain OS=Salmonella paratyphi C (strain RKS4594) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|Q5PKX3|ATPE_SALPA | ATP synthase epsilon chain OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|B4SYD0|ATPE_SALNS | ATP synthase epsilon chain OS=Salmonella newport (strain SL254) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|B5RFW4|ATPE_SALG2 | ATP synthase epsilon chain OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|B5QUS3|ATPE_SALEP | ATP synthase epsilon chain OS=Salmonella enteritidis PT4 (strain P125109) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|Q57HY0|ATPE_SALCH | ATP synthase epsilon chain OS=Salmonella choleraesuis (strain SC-B67) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|B5EYZ5|ATPE_SALA4 | ATP synthase epsilon chain OS=Salmonella agona (strain SL483) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|A6TG35|ATPE_KLEP7 | ATP synthase epsilon chain OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|Q8XU77|ATPE1_RALSO | ATP synthase epsilon chain 1 OS=Ralstonia solanacearum (strain GMI1000) GN=atpC1 PE=3 SV=1 | 49 | 156 | 1.0E-08 |
| sp|A4WGF6|ATPE_ENT38 | ATP synthase epsilon chain OS=Enterobacter sp. (strain 638) GN=atpC PE=3 SV=1 | 52 | 154 | 1.0E-08 |
| sp|B2VCA3|ATPE_ERWT9 | ATP synthase epsilon chain OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=atpC PE=3 SV=1 | 49 | 152 | 1.0E-08 |
| sp|Q0C101|ATPE_HYPNA | ATP synthase epsilon chain OS=Hyphomonas neptunium (strain ATCC 15444) GN=atpC PE=3 SV=1 | 33 | 135 | 2.0E-08 |
| sp|P37812|ATPE_BACSU | ATP synthase epsilon chain OS=Bacillus subtilis (strain 168) GN=atpC PE=1 SV=1 | 35 | 155 | 2.0E-08 |
| sp|Q4FP39|ATPE_PELUB | ATP synthase epsilon chain OS=Pelagibacter ubique (strain HTCC1062) GN=atpC PE=3 SV=1 | 33 | 161 | 2.0E-08 |
| sp|Q3BP16|ATPE_XANC5 | ATP synthase epsilon chain OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=atpC PE=3 SV=1 | 60 | 165 | 2.0E-08 |
| sp|Q8PGG8|ATPE_XANAC | ATP synthase epsilon chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=atpC PE=3 SV=1 | 60 | 165 | 2.0E-08 |
| sp|Q5QZH3|ATPE_IDILO | ATP synthase epsilon chain OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=atpC PE=3 SV=1 | 52 | 154 | 2.0E-08 |
| sp|Q2P7Q3|ATPE_XANOM | ATP synthase epsilon chain OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=atpC PE=3 SV=1 | 60 | 165 | 2.0E-08 |
| sp|Q1LHL1|ATPE_CUPMC | ATP synthase epsilon chain OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=atpC PE=3 SV=1 | 55 | 153 | 2.0E-08 |
| sp|B2FHY7|ATPE_STRMK | ATP synthase epsilon chain OS=Stenotrophomonas maltophilia (strain K279a) GN=atpC PE=3 SV=1 | 60 | 165 | 2.0E-08 |
| sp|B4SJR8|ATPE_STRM5 | ATP synthase epsilon chain OS=Stenotrophomonas maltophilia (strain R551-3) GN=atpC PE=3 SV=1 | 60 | 165 | 2.0E-08 |
| sp|B1KQ33|ATPE_SHEWM | ATP synthase epsilon chain OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=atpC PE=3 SV=1 | 35 | 108 | 3.0E-08 |
| sp|A9MJS1|ATPE_SALAR | ATP synthase epsilon chain OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|A8G1W4|ATPE_SHESH | ATP synthase epsilon chain OS=Shewanella sediminis (strain HAW-EB3) GN=atpC PE=3 SV=1 | 35 | 108 | 3.0E-08 |
| sp|Q2NQ85|ATPE_SODGM | ATP synthase epsilon chain OS=Sodalis glossinidius (strain morsitans) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|Q12HQ2|ATPE_SHEDO | ATP synthase epsilon chain OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=atpC PE=3 SV=1 | 35 | 164 | 3.0E-08 |
| sp|Q3YVN5|ATPE_SHISS | ATP synthase epsilon chain OS=Shigella sonnei (strain Ss046) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|P0A6E8|ATPE_SHIFL | ATP synthase epsilon chain OS=Shigella flexneri GN=atpC PE=3 SV=2 | 52 | 154 | 3.0E-08 |
| sp|Q0SYU5|ATPE_SHIF8 | ATP synthase epsilon chain OS=Shigella flexneri serotype 5b (strain 8401) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|Q329S0|ATPE_SHIDS | ATP synthase epsilon chain OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7LK76|ATPE_ESCF3 | ATP synthase epsilon chain OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|Q1R4K3|ATPE_ECOUT | ATP synthase epsilon chain OS=Escherichia coli (strain UTI89 / UPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B1LL58|ATPE_ECOSM | ATP synthase epsilon chain OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B6I3W8|ATPE_ECOSE | ATP synthase epsilon chain OS=Escherichia coli (strain SE11) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7NF47|ATPE_ECOLU | ATP synthase epsilon chain OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|P0A6E6|ATPE_ECOLI | ATP synthase epsilon chain OS=Escherichia coli (strain K12) GN=atpC PE=1 SV=2 | 52 | 154 | 3.0E-08 |
| sp|B1IX07|ATPE_ECOLC | ATP synthase epsilon chain OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|P0A6E7|ATPE_ECOL6 | ATP synthase epsilon chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=atpC PE=3 SV=2 | 52 | 154 | 3.0E-08 |
| sp|Q0TAX8|ATPE_ECOL5 | ATP synthase epsilon chain OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|A8A6J4|ATPE_ECOHS | ATP synthase epsilon chain OS=Escherichia coli O9:H4 (strain HS) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B1X9V9|ATPE_ECODH | ATP synthase epsilon chain OS=Escherichia coli (strain K12 / DH10B) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|C4ZZ09|ATPE_ECOBW | ATP synthase epsilon chain OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7M587|ATPE_ECO8A | ATP synthase epsilon chain OS=Escherichia coli O8 (strain IAI1) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7N2H0|ATPE_ECO81 | ATP synthase epsilon chain OS=Escherichia coli O81 (strain ED1a) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7NR33|ATPE_ECO7I | ATP synthase epsilon chain OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B5YXD5|ATPE_ECO5E | ATP synthase epsilon chain OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7L881|ATPE_ECO55 | ATP synthase epsilon chain OS=Escherichia coli (strain 55989 / EAEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7MGF1|ATPE_ECO45 | ATP synthase epsilon chain OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B7UMJ6|ATPE_ECO27 | ATP synthase epsilon chain OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|A7ZTU3|ATPE_ECO24 | ATP synthase epsilon chain OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-08 |
| sp|B4U9G2|ATPE_HYDS0 | ATP synthase epsilon chain OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=atpC PE=3 SV=1 | 35 | 160 | 3.0E-08 |
| sp|A4SUT5|ATPE_POLSQ | ATP synthase epsilon chain OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=atpC PE=3 SV=1 | 55 | 154 | 4.0E-08 |
| sp|B8CVU4|ATPE_SHEPW | ATP synthase epsilon chain OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=atpC PE=3 SV=1 | 52 | 108 | 4.0E-08 |
| sp|A8G7M9|ATPE_SERP5 | ATP synthase epsilon chain OS=Serratia proteamaculans (strain 568) GN=atpC PE=3 SV=1 | 52 | 154 | 4.0E-08 |
| sp|Q28TJ5|ATPE_JANSC | ATP synthase epsilon chain OS=Jannaschia sp. (strain CCS1) GN=atpC PE=3 SV=1 | 49 | 136 | 4.0E-08 |
| sp|Q8PCZ4|ATPE_XANCP | ATP synthase epsilon chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=atpC PE=3 SV=1 | 60 | 165 | 4.0E-08 |
| sp|B0RWC1|ATPE_XANCB | ATP synthase epsilon chain OS=Xanthomonas campestris pv. campestris (strain B100) GN=atpC PE=3 SV=1 | 60 | 165 | 4.0E-08 |
| sp|Q4UQF5|ATPE_XANC8 | ATP synthase epsilon chain OS=Xanthomonas campestris pv. campestris (strain 8004) GN=atpC PE=3 SV=1 | 60 | 165 | 4.0E-08 |
| sp|Q0A4M9|ATPE_ALKEH | ATP synthase epsilon chain OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=atpC PE=3 SV=1 | 59 | 165 | 4.0E-08 |
| sp|P72248|ATPE_RHOCA | ATP synthase epsilon chain OS=Rhodobacter capsulatus GN=atpC PE=1 SV=3 | 54 | 165 | 5.0E-08 |
| sp|A7MMW8|ATPE_CROS8 | ATP synthase epsilon chain OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=atpC PE=3 SV=1 | 52 | 154 | 5.0E-08 |
| sp|Q223D7|ATPE_RHOFT | ATP synthase epsilon chain OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=atpC PE=3 SV=1 | 33 | 157 | 5.0E-08 |
| sp|A6VL56|ATPE_ACTSZ | ATP synthase epsilon chain OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=atpC PE=3 SV=1 | 62 | 120 | 5.0E-08 |
| sp|Q46VY1|ATPE_CUPPJ | ATP synthase epsilon chain OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=atpC PE=3 SV=1 | 55 | 153 | 6.0E-08 |
| sp|B4F0E8|ATPE_PROMH | ATP synthase epsilon chain OS=Proteus mirabilis (strain HI4320) GN=atpC PE=3 SV=1 | 51 | 154 | 6.0E-08 |
| sp|Q8E8C1|ATPE_SHEON | ATP synthase epsilon chain OS=Shewanella oneidensis (strain MR-1) GN=atpC PE=3 SV=1 | 35 | 164 | 6.0E-08 |
| sp|A7Z9P9|ATPE_BACMF | ATP synthase epsilon chain OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpC PE=3 SV=1 | 35 | 108 | 7.0E-08 |
| sp|Q1QPU2|ATPE2_NITHX | ATP synthase epsilon chain 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpC2 PE=3 SV=1 | 34 | 153 | 7.0E-08 |
| sp|A3QJQ9|ATPE_SHELP | ATP synthase epsilon chain OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=atpC PE=3 SV=1 | 52 | 108 | 7.0E-08 |
| sp|Q0HPG2|ATPE_SHESR | ATP synthase epsilon chain OS=Shewanella sp. (strain MR-7) GN=atpC PE=3 SV=1 | 35 | 164 | 8.0E-08 |
| sp|Q0HD80|ATPE_SHESM | ATP synthase epsilon chain OS=Shewanella sp. (strain MR-4) GN=atpC PE=3 SV=1 | 35 | 164 | 8.0E-08 |
| sp|A0L2S7|ATPE_SHESA | ATP synthase epsilon chain OS=Shewanella sp. (strain ANA-3) GN=atpC PE=3 SV=1 | 35 | 164 | 8.0E-08 |
| sp|A3DAR3|ATPE_SHEB5 | ATP synthase epsilon chain OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=atpC PE=3 SV=1 | 49 | 164 | 9.0E-08 |
| sp|Q1GXN1|ATPE_METFK | ATP synthase epsilon chain OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=atpC PE=3 SV=1 | 59 | 160 | 1.0E-07 |
| sp|Q9PE86|ATPE_XYLFA | ATP synthase epsilon chain OS=Xylella fastidiosa (strain 9a5c) GN=atpC PE=3 SV=2 | 60 | 165 | 1.0E-07 |
| sp|Q12GP9|ATPE_POLSJ | ATP synthase epsilon chain OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=atpC PE=3 SV=1 | 55 | 157 | 1.0E-07 |
| sp|C6DJH3|ATPE_PECCP | ATP synthase epsilon chain OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=atpC PE=3 SV=1 | 52 | 124 | 1.0E-07 |
| sp|A1W2T8|ATPE_ACISJ | ATP synthase epsilon chain OS=Acidovorax sp. (strain JS42) GN=atpC PE=3 SV=1 | 55 | 157 | 2.0E-07 |
| sp|B9MBA4|ATPE_ACIET | ATP synthase epsilon chain OS=Acidovorax ebreus (strain TPSY) GN=atpC PE=3 SV=1 | 55 | 157 | 2.0E-07 |
| sp|A8FIB1|ATPE_BACP2 | ATP synthase epsilon chain OS=Bacillus pumilus (strain SAFR-032) GN=atpC PE=3 SV=1 | 35 | 108 | 2.0E-07 |
| sp|Q5LNP2|ATPE_RUEPO | ATP synthase epsilon chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpC PE=3 SV=1 | 44 | 135 | 2.0E-07 |
| sp|Q9CKW0|ATPE_PASMU | ATP synthase epsilon chain OS=Pasteurella multocida (strain Pm70) GN=atpC PE=3 SV=1 | 62 | 120 | 2.0E-07 |
| sp|Q4K3B0|ATPE_PSEF5 | ATP synthase epsilon chain OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=atpC PE=3 SV=1 | 59 | 108 | 2.0E-07 |
| sp|Q0K5M8|ATPE_CUPNH | ATP synthase epsilon chain OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=atpC PE=3 SV=1 | 55 | 153 | 2.0E-07 |
| sp|A4Y186|ATPE_PSEMY | ATP synthase epsilon chain OS=Pseudomonas mendocina (strain ymp) GN=atpC PE=3 SV=1 | 62 | 108 | 2.0E-07 |
| sp|Q162T0|ATPE_ROSDO | ATP synthase epsilon chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=atpC PE=3 SV=1 | 33 | 108 | 2.0E-07 |
| sp|Q1LTV5|ATPE_BAUCH | ATP synthase epsilon chain OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=atpC PE=3 SV=1 | 54 | 154 | 2.0E-07 |
| sp|Q87KA9|ATPE_VIBPA | ATP synthase epsilon chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=atpC PE=3 SV=1 | 49 | 154 | 2.0E-07 |
| sp|Q98EV9|ATPE_RHILO | ATP synthase epsilon chain OS=Rhizobium loti (strain MAFF303099) GN=atpC PE=3 SV=1 | 33 | 105 | 2.0E-07 |
| sp|Q6CYJ6|ATPE_PECAS | ATP synthase epsilon chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=atpC PE=3 SV=1 | 52 | 124 | 3.0E-07 |
| sp|A8HAG2|ATPE_SHEPA | ATP synthase epsilon chain OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=atpC PE=3 SV=1 | 35 | 108 | 3.0E-07 |
| sp|Q663Q9|ATPE_YERPS | ATP synthase epsilon chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|A4TSJ4|ATPE_YERPP | ATP synthase epsilon chain OS=Yersinia pestis (strain Pestoides F) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|Q1CCH6|ATPE_YERPN | ATP synthase epsilon chain OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|Q1C096|ATPE_YERPA | ATP synthase epsilon chain OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|A3N2U3|ATPE_ACTP2 | ATP synthase epsilon chain OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=atpC PE=3 SV=1 | 34 | 105 | 3.0E-07 |
| sp|B0TQF3|ATPE_SHEHH | ATP synthase epsilon chain OS=Shewanella halifaxensis (strain HAW-EB4) GN=atpC PE=3 SV=1 | 35 | 108 | 3.0E-07 |
| sp|Q87E91|ATPE_XYLFT | ATP synthase epsilon chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=atpC PE=3 SV=1 | 60 | 165 | 3.0E-07 |
| sp|Q7NA95|ATPE_PHOLL | ATP synthase epsilon chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|B1JRN3|ATPE_YERPY | ATP synthase epsilon chain OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|A9R5T8|ATPE_YERPG | ATP synthase epsilon chain OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|P58647|ATPE_YERPE | ATP synthase epsilon chain OS=Yersinia pestis GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|B2K848|ATPE_YERPB | ATP synthase epsilon chain OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|A7FPD9|ATPE_YERP3 | ATP synthase epsilon chain OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpC PE=3 SV=1 | 52 | 154 | 3.0E-07 |
| sp|B0UWG4|ATPE_HISS2 | ATP synthase epsilon chain OS=Histophilus somni (strain 2336) GN=atpC PE=3 SV=1 | 62 | 147 | 3.0E-07 |
| sp|A1JTC5|ATPE_YERE8 | ATP synthase epsilon chain OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=atpC PE=3 SV=1 | 52 | 154 | 4.0E-07 |
| sp|B9E8E5|ATPE_MACCJ | ATP synthase epsilon chain OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpC PE=3 SV=1 | 33 | 108 | 4.0E-07 |
| sp|Q0I5X4|ATPE_HAES1 | ATP synthase epsilon chain OS=Haemophilus somnus (strain 129Pt) GN=atpC PE=3 SV=1 | 62 | 147 | 4.0E-07 |
| sp|B0BRX1|ATPE_ACTPJ | ATP synthase epsilon chain OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=atpC PE=3 SV=1 | 34 | 120 | 4.0E-07 |
| sp|B3H2P2|ATPE_ACTP7 | ATP synthase epsilon chain OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=atpC PE=3 SV=1 | 34 | 120 | 4.0E-07 |
| sp|C3M9S0|ATPE_RHISN | ATP synthase epsilon chain OS=Rhizobium sp. (strain NGR234) GN=atpC PE=3 SV=1 | 33 | 105 | 5.0E-07 |
| sp|A6Q4B9|ATPE_NITSB | ATP synthase epsilon chain OS=Nitratiruptor sp. (strain SB155-2) GN=atpC PE=3 SV=1 | 33 | 137 | 5.0E-07 |
| sp|A9KX05|ATPE_SHEB9 | ATP synthase epsilon chain OS=Shewanella baltica (strain OS195) GN=atpC PE=3 SV=1 | 49 | 164 | 5.0E-07 |
| sp|A6WUI9|ATPE_SHEB8 | ATP synthase epsilon chain OS=Shewanella baltica (strain OS185) GN=atpC PE=3 SV=1 | 49 | 164 | 5.0E-07 |
| sp|B8EDU9|ATPE_SHEB2 | ATP synthase epsilon chain OS=Shewanella baltica (strain OS223) GN=atpC PE=3 SV=1 | 49 | 164 | 5.0E-07 |
| sp|Q11DD4|ATPE_CHESB | ATP synthase epsilon chain OS=Chelativorans sp. (strain BNC1) GN=atpC PE=3 SV=1 | 44 | 105 | 5.0E-07 |
| sp|Q3K442|ATPE_PSEPF | ATP synthase epsilon chain OS=Pseudomonas fluorescens (strain Pf0-1) GN=atpC PE=3 SV=1 | 62 | 108 | 5.0E-07 |
| sp|Q31UN1|ATPE_SHIBS | ATP synthase epsilon chain OS=Shigella boydii serotype 4 (strain Sb227) GN=atpC PE=3 SV=1 | 52 | 154 | 5.0E-07 |
| sp|B2TUP4|ATPE_SHIB3 | ATP synthase epsilon chain OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=atpC PE=3 SV=1 | 52 | 154 | 5.0E-07 |
| sp|P12988|ATPE_VIBAL | ATP synthase epsilon chain OS=Vibrio alginolyticus GN=atpC PE=3 SV=1 | 56 | 154 | 5.0E-07 |
| sp|Q2VZN3|ATPE_MAGSA | ATP synthase epsilon chain OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=atpC PE=3 SV=1 | 33 | 150 | 6.0E-07 |
| sp|B1JFU0|ATPE_PSEPW | ATP synthase epsilon chain OS=Pseudomonas putida (strain W619) GN=atpC PE=3 SV=1 | 62 | 108 | 6.0E-07 |
| sp|Q65Q08|ATPE_MANSM | ATP synthase epsilon chain OS=Mannheimia succiniciproducens (strain MBEL55E) GN=atpC PE=3 SV=1 | 62 | 156 | 7.0E-07 |
| sp|Q48BG6|ATPE_PSE14 | ATP synthase epsilon chain OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=atpC PE=3 SV=1 | 62 | 108 | 7.0E-07 |
| sp|Q9HT21|ATPE_PSEAE | ATP synthase epsilon chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atpC PE=3 SV=1 | 62 | 108 | 7.0E-07 |
| sp|Q02DF5|ATPE_PSEAB | ATP synthase epsilon chain OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=atpC PE=3 SV=1 | 62 | 108 | 7.0E-07 |
| sp|B7V790|ATPE_PSEA8 | ATP synthase epsilon chain OS=Pseudomonas aeruginosa (strain LESB58) GN=atpC PE=3 SV=1 | 62 | 108 | 7.0E-07 |
| sp|A6VF31|ATPE_PSEA7 | ATP synthase epsilon chain OS=Pseudomonas aeruginosa (strain PA7) GN=atpC PE=3 SV=1 | 62 | 108 | 7.0E-07 |
| sp|Q5E1N8|ATPE_VIBF1 | ATP synthase epsilon chain OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=atpC PE=3 SV=1 | 55 | 158 | 7.0E-07 |
| sp|Q6LLG9|ATPE1_PHOPR | ATP synthase epsilon chain 1 OS=Photobacterium profundum GN=atpC1 PE=3 SV=1 | 55 | 158 | 8.0E-07 |
| sp|A1B8P1|ATPE_PARDP | ATP synthase epsilon chain OS=Paracoccus denitrificans (strain Pd 1222) GN=atpC PE=1 SV=1 | 33 | 164 | 9.0E-07 |
| sp|A1WF59|ATPE_VEREI | ATP synthase epsilon chain OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpC PE=3 SV=1 | 33 | 157 | 9.0E-07 |
| sp|Q2S6P2|ATPE_HAHCH | ATP synthase epsilon chain OS=Hahella chejuensis (strain KCTC 2396) GN=atpC PE=3 SV=1 | 52 | 108 | 9.0E-07 |
| sp|Q87TT5|ATPE_PSESM | ATP synthase epsilon chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=atpC PE=3 SV=1 | 62 | 108 | 1.0E-06 |
| sp|P58646|ATPE_ECO57 | ATP synthase epsilon chain OS=Escherichia coli O157:H7 GN=atpC PE=3 SV=2 | 52 | 154 | 1.0E-06 |
| sp|Q4ZL25|ATPE_PSEU2 | ATP synthase epsilon chain OS=Pseudomonas syringae pv. syringae (strain B728a) GN=atpC PE=3 SV=1 | 62 | 108 | 1.0E-06 |
| sp|B8FGT3|ATPE_DESAA | ATP synthase epsilon chain OS=Desulfatibacillum alkenivorans (strain AK-01) GN=atpC PE=3 SV=1 | 35 | 151 | 1.0E-06 |
| sp|Q07VU5|ATPE_SHEFN | ATP synthase epsilon chain OS=Shewanella frigidimarina (strain NCIMB 400) GN=atpC PE=3 SV=1 | 35 | 154 | 1.0E-06 |
| sp|Q9KNH6|ATPE_VIBCH | ATP synthase epsilon chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=atpC PE=3 SV=1 | 56 | 154 | 1.0E-06 |
| sp|B8GRB7|ATPE_THISH | ATP synthase epsilon chain OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpC PE=3 SV=1 | 44 | 165 | 2.0E-06 |
| sp|Q1GEU9|ATPE_RUEST | ATP synthase epsilon chain OS=Ruegeria sp. (strain TM1040) GN=atpC PE=3 SV=1 | 33 | 164 | 2.0E-06 |
| sp|A9WWS1|ATPE_BRUSI | ATP synthase epsilon chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|A1VIV3|ATPE_POLNA | ATP synthase epsilon chain OS=Polaromonas naphthalenivorans (strain CJ2) GN=atpC PE=3 SV=1 | 55 | 157 | 2.0E-06 |
| sp|A5WBA2|ATPE_PSEP1 | ATP synthase epsilon chain OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpC PE=3 SV=1 | 62 | 108 | 2.0E-06 |
| sp|P63661|ATPE_BRUSU | ATP synthase epsilon chain OS=Brucella suis biovar 1 (strain 1330) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|P63660|ATPE_BRUME | ATP synthase epsilon chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|C0RF49|ATPE_BRUMB | ATP synthase epsilon chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|A9M836|ATPE_BRUC2 | ATP synthase epsilon chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|Q57B89|ATPE_BRUAB | ATP synthase epsilon chain OS=Brucella abortus biovar 1 (strain 9-941) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|Q2YLE7|ATPE_BRUA2 | ATP synthase epsilon chain OS=Brucella abortus (strain 2308) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|B2S7M2|ATPE_BRUA1 | ATP synthase epsilon chain OS=Brucella abortus (strain S19) GN=atpC PE=3 SV=1 | 44 | 160 | 2.0E-06 |
| sp|A7GV55|ATPE_BACCN | ATP synthase epsilon chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpC PE=3 SV=1 | 37 | 108 | 2.0E-06 |
| sp|B7IQV7|ATPE_BACC2 | ATP synthase epsilon chain OS=Bacillus cereus (strain G9842) GN=atpC PE=3 SV=1 | 37 | 113 | 2.0E-06 |
| sp|B7JGM9|ATPE_BACC0 | ATP synthase epsilon chain OS=Bacillus cereus (strain AH820) GN=atpC PE=3 SV=1 | 37 | 113 | 2.0E-06 |
| sp|Q81JZ6|ATPE_BACAN | ATP synthase epsilon chain OS=Bacillus anthracis GN=atpC PE=3 SV=1 | 37 | 113 | 2.0E-06 |
| sp|C3LFH8|ATPE_BACAC | ATP synthase epsilon chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpC PE=3 SV=1 | 37 | 113 | 2.0E-06 |
| sp|C3P1F3|ATPE_BACAA | ATP synthase epsilon chain OS=Bacillus anthracis (strain A0248) GN=atpC PE=3 SV=1 | 37 | 113 | 2.0E-06 |
| sp|A9VSA2|ATPE_BACWK | ATP synthase epsilon chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|Q6HAY1|ATPE_BACHK | ATP synthase epsilon chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|Q630U4|ATPE_BACCZ | ATP synthase epsilon chain OS=Bacillus cereus (strain ZK / E33L) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|Q814W3|ATPE_BACCR | ATP synthase epsilon chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|B9IRT6|ATPE_BACCQ | ATP synthase epsilon chain OS=Bacillus cereus (strain Q1) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|B7HY63|ATPE_BACC7 | ATP synthase epsilon chain OS=Bacillus cereus (strain AH187) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|B7HFK0|ATPE_BACC4 | ATP synthase epsilon chain OS=Bacillus cereus (strain B4264) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|C1F0M7|ATPE_BACC3 | ATP synthase epsilon chain OS=Bacillus cereus (strain 03BB102) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|Q72XE9|ATPE_BACC1 | ATP synthase epsilon chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|A0RL94|ATPE_BACAH | ATP synthase epsilon chain OS=Bacillus thuringiensis (strain Al Hakam) GN=atpC PE=3 SV=1 | 37 | 113 | 3.0E-06 |
| sp|Q88BX5|ATPE_PSEPK | ATP synthase epsilon chain OS=Pseudomonas putida (strain KT2440) GN=atpC PE=3 SV=1 | 62 | 108 | 3.0E-06 |
| sp|Q1I2I8|ATPE_PSEE4 | ATP synthase epsilon chain OS=Pseudomonas entomophila (strain L48) GN=atpC PE=3 SV=1 | 62 | 108 | 3.0E-06 |
| sp|B1I6J6|ATPE_DESAP | ATP synthase epsilon chain OS=Desulforudis audaxviator (strain MP104C) GN=atpC PE=3 SV=1 | 36 | 115 | 3.0E-06 |
| sp|A1K1S3|ATPE_AZOSB | ATP synthase epsilon chain OS=Azoarcus sp. (strain BH72) GN=atpC PE=3 SV=1 | 55 | 154 | 3.0E-06 |
| sp|B0KRA7|ATPE_PSEPG | ATP synthase epsilon chain OS=Pseudomonas putida (strain GB-1) GN=atpC PE=3 SV=1 | 62 | 108 | 4.0E-06 |
| sp|Q0VKX5|ATPE_ALCBS | ATP synthase epsilon chain OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=atpC PE=3 SV=1 | 62 | 105 | 4.0E-06 |
| sp|C3K1E5|ATPE_PSEFS | ATP synthase epsilon chain OS=Pseudomonas fluorescens (strain SBW25) GN=atpC PE=3 SV=1 | 62 | 108 | 5.0E-06 |
| sp|B1XSD5|ATPE_POLNS | ATP synthase epsilon chain OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=atpC PE=3 SV=1 | 55 | 154 | 5.0E-06 |
| sp|A6W3S7|ATPE_MARMS | ATP synthase epsilon chain OS=Marinomonas sp. (strain MWYL1) GN=atpC PE=3 SV=1 | 52 | 108 | 5.0E-06 |
| sp|Q8VV76|ATPE_COLMA | ATP synthase epsilon chain OS=Colwellia maris GN=atpC PE=3 SV=1 | 35 | 108 | 5.0E-06 |
| sp|A6WXX2|ATPE_OCHA4 | ATP synthase epsilon chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=atpC PE=3 SV=1 | 44 | 160 | 6.0E-06 |
| sp|Q7VPN9|ATPE_HAEDU | ATP synthase epsilon chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=atpC PE=3 SV=1 | 34 | 120 | 6.0E-06 |
| sp|Q7MGI1|ATPE_VIBVY | ATP synthase epsilon chain OS=Vibrio vulnificus (strain YJ016) GN=atpC PE=3 SV=1 | 49 | 120 | 7.0E-06 |
| sp|Q8DDG7|ATPE_VIBVU | ATP synthase epsilon chain OS=Vibrio vulnificus (strain CMCP6) GN=atpC PE=3 SV=1 | 49 | 120 | 7.0E-06 |
| sp|C5BKJ4|ATPE_TERTT | ATP synthase epsilon chain OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=atpC PE=3 SV=1 | 58 | 108 | 8.0E-06 |
| sp|A9H9B1|ATPE_GLUDA | ATP synthase epsilon chain OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpC PE=3 SV=1 | 35 | 165 | 9.0E-06 |
| sp|Q5P4E1|ATPE_AROAE | ATP synthase epsilon chain OS=Aromatoleum aromaticum (strain EbN1) GN=atpC PE=3 SV=1 | 55 | 154 | 9.0E-06 |
| sp|Q4L7Y3|ATPE_STAHJ | ATP synthase epsilon chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpC PE=3 SV=1 | 35 | 111 | 9.0E-06 |
| sp|A1WZT0|ATPE_HALHL | ATP synthase epsilon chain OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpC PE=3 SV=1 | 44 | 165 | 9.0E-06 |
| sp|A1U7H3|ATPE_MARHV | ATP synthase epsilon chain OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=atpC PE=3 SV=1 | 44 | 124 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0015986 | proton motive force-driven ATP synthesis | Yes |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0009145 | purine nucleoside triphosphate biosynthetic process | No |
| GO:0009144 | purine nucleoside triphosphate metabolic process | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0019637 | organophosphate metabolic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:0006796 | phosphate-containing compound metabolic process | No |
| GO:0009259 | ribonucleotide metabolic process | No |
| GO:1901137 | carbohydrate derivative biosynthetic process | No |
| GO:0006754 | ATP biosynthetic process | No |
| GO:1901293 | nucleoside phosphate biosynthetic process | No |
| GO:1901135 | carbohydrate derivative metabolic process | No |
| GO:0009150 | purine ribonucleotide metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0006793 | phosphorus metabolic process | No |
| GO:0019693 | ribose phosphate metabolic process | No |
| GO:0090407 | organophosphate biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0034654 | nucleobase-containing compound biosynthetic process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0009152 | purine ribonucleotide biosynthetic process | No |
| GO:0009206 | purine ribonucleoside triphosphate biosynthetic process | No |
| GO:0009199 | ribonucleoside triphosphate metabolic process | No |
| GO:0009117 | nucleotide metabolic process | No |
| GO:0009142 | nucleoside triphosphate biosynthetic process | No |
| GO:0009165 | nucleotide biosynthetic process | No |
| GO:0009201 | ribonucleoside triphosphate biosynthetic process | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0009205 | purine ribonucleoside triphosphate metabolic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0006753 | nucleoside phosphate metabolic process | No |
| GO:0072521 | purine-containing compound metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0009141 | nucleoside triphosphate metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0008152 | metabolic process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0006163 | purine nucleotide metabolic process | No |
| GO:0046034 | ATP metabolic process | No |
| GO:0046390 | ribose phosphate biosynthetic process | No |
| GO:0072522 | purine-containing compound biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0009260 | ribonucleotide biosynthetic process | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0006164 | purine nucleotide biosynthetic process | No |
| GO:0055086 | nucleobase-containing small molecule metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 15 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|1346 MNSLCVARAALRARPAAMRIVAQRRTYAEAVPDKIKLSMTLPHEAIYKSQDVVQVNIAAESGDMGVLANHVPSIE QLKPGIVEIVEEAGGAKQYFLSGGFATVQPGSVMSINAVEGFPLEDFSADAIRSQIAEAQKVASGGGSEQDIAEA KIELEVLETLSAHVK* |
| Coding | >OphauB2|1346 ATGAATTCCCTTTGCGTCGCCCGCGCGGCCTTGAGAGCCCGTCCTGCTGCCATGCGGATTGTCGCCCAGCGGAGA ACATACGCCGAGGCCGTTCCAGACAAGATCAAGTTGAGCATGACACTACCTCACGAGGCCATCTACAAGTCGCAG GATGTCGTCCAGGTCAACATTGCGGCAGAGTCGGGCGACATGGGCGTTCTCGCAAACCACGTGCCTTCAATTGAG CAGCTCAAGCCTGGCATTGTCGAGATTGTCGAGGAGGCTGGCGGCGCCAAGCAATACTTTCTCTCTGGAGGCTTT GCTACAGTTCAACCCGGCTCAGTCATGAGCATCAATGCTGTCGAAGGCTTCCCCCTTGAAGACTTTAGCGCCGAT GCTATCCGGTCTCAGATTGCAGAAGCACAAAAGGTGGCTAGCGGCGGAGGCAGTGAACAGGACATTGCCGAAGCC AAGATTGAGCTCGAGGTTCTGGAGACGCTCTCTGCTCATGTCAAATAG |
| Transcript | >OphauB2|1346 ATGAATTCCCTTTGCGTCGCCCGCGCGGCCTTGAGAGCCCGTCCTGCTGCCATGCGGATTGTCGCCCAGCGGAGA ACATACGCCGAGGCCGTTCCAGACAAGATCAAGTTGAGCATGACACTACCTCACGAGGCCATCTACAAGTCGCAG GATGTCGTCCAGGTCAACATTGCGGCAGAGTCGGGCGACATGGGCGTTCTCGCAAACCACGTGCCTTCAATTGAG CAGCTCAAGCCTGGCATTGTCGAGATTGTCGAGGAGGCTGGCGGCGCCAAGCAATACTTTCTCTCTGGAGGCTTT GCTACAGTTCAACCCGGCTCAGTCATGAGCATCAATGCTGTCGAAGGCTTCCCCCTTGAAGACTTTAGCGCCGAT GCTATCCGGTCTCAGATTGCAGAAGCACAAAAGGTGGCTAGCGGCGGAGGCAGTGAACAGGACATTGCCGAAGCC AAGATTGAGCTCGAGGTTCTGGAGACGCTCTCTGCTCATGTCAAATAG |
| Gene | >OphauB2|1346 ATGAATTCCCTTTGCGTCGCCCGCGCGGCCTTGAGAGCCCGTCCTGCTGCCATGCGGATTGTCGCCCAGCGGAGA ACATACGCCGAGGCCGTTCCAGACAAGGTCAGTCCTCCTTTTCCTTGCCCCATTGGCACGGCACCTCTGCTTCCA GGGTGCTCGAACTCGCATCAATGAAACTCTGGTTGACACAATCTATAGATCAAGTTGAGCATGACACTACCTCAC GAGGTATGCGTGAGCTAGAGGCGTCACACCTGCCAATACGCGCCACCATGTCAGCGACTAGTCAAGCTAATTGCC GCAATTGTCAGGCCATCTACAAGTCGCAGGATGTCGTCCAGGTCAACATTGCGGCAGAGTCGGGCGACATGGGCG TTCTCGCAAACCACGTGCCTTCAATTGAGCAGCTCAAGCCTGGCATTGTCGAGATTGTCGAGGAGGCTGGCGGCG CCAAGCAATACTTTCGTACGTGACGCCATGTCTAAGCCATTTGTCTTCTTGCTCCCTGTGACAGGCTTGCAAGGC TAATGACGAGTCTTGCAGTCTCTGGAGGCTTTGCTACAGTTCAACCCGGCTCAGTCATGAGCATCAATGCTGTCG AAGGCTTCCCCCTTGAAGACTTTAGCGCCGATGCTATCCGGTCTCAGATTGCAGAAGCACAAAAGGTGGCTAGCG GCGGAGGCAGTGAACAGGACATTGCCGAAGCCAAGATTGAGCTCGAGGTATGTTGACGGTGCCTTGCCCTCCCAT GAGTATTTTCCAGTGATGCTAACCTGCACTCAAGGTTCTGGAGACGCTCTCTGCTCATGTCAAATAG |