Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1333
Gene name
LocationContig_132:52302..53194
Strand-
Gene length (bp)892
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09637 Med18 Med18 protein 3.0E-26 3 260

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0031323 regulation of cellular metabolic process No
GO:0005575 cellular_component No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0050794 regulation of cellular process No
GO:0140513 nuclear protein-containing complex No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0032991 protein-containing complex No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1333
MYELFLTALVEPGDLEAACSVLGGLCSMTPWETISRVVYYQGPSKPTGISNQTSIDKPMRKDTALLWKDLHQNLS
RQSYILQARYDVSKQRDMGPQAVAMDLNSTPGILRWTDFPDPPHGRPLIIQRKFVDIWEQKKLPCVMRDNQYRYK
SEVMEQQYRFFREETEFCLTRQYFLGSISNYTPLESRQHQSEPLATLPSWESLTPVDMQNRWILHVKVHVLQDSK
PDELRKAQDQLTAIKTELEGAFELKAIDRKAHDTRVALQPQGVQALPNKVILGKN*
Coding >OphauB2|1333
ATGTACGAGCTCTTCCTGACAGCGCTCGTAGAGCCAGGCGACTTGGAGGCGGCCTGCTCTGTGCTGGGCGGCCTG
TGTTCCATGACGCCATGGGAAACCATTAGCCGTGTTGTTTACTATCAAGGCCCTTCCAAGCCGACAGGCATCTCC
AACCAGACATCCATCGACAAGCCCATGCGCAAGGACACGGCGCTGCTGTGGAAAGATTTGCATCAGAACCTAAGT
CGCCAGTCCTACATACTTCAGGCCCGCTACGACGTCTCCAAACAAAGAGACATGGGTCCTCAGGCCGTGGCAATG
GATCTCAACAGCACGCCCGGCATCTTGCGTTGGACCGATTTTCCTGATCCGCCGCATGGTAGACCGCTTATTATA
CAGCGCAAGTTTGTTGATATCTGGGAGCAAAAGAAGCTGCCTTGTGTGATGCGCGATAATCAATACAGATACAAA
TCCGAAGTCATGGAGCAGCAATACCGCTTCTTCCGCGAAGAGACCGAGTTCTGCTTGACAAGGCAATATTTCCTA
GGCTCAATCAGCAACTACACACCGCTCGAGTCAAGGCAACACCAGTCTGAGCCCTTGGCAACGCTGCCTAGTTGG
GAGTCTTTGACGCCTGTTGACATGCAGAATCGATGGATTTTGCATGTCAAGGTGCACGTTCTTCAAGACAGCAAA
CCCGACGAACTGCGCAAAGCCCAGGATCAACTCACCGCCATCAAGACGGAGCTGGAAGGTGCCTTTGAGCTCAAA
GCCATTGACCGCAAGGCCCACGACACACGCGTGGCCTTGCAGCCCCAGGGCGTTCAAGCACTGCCCAACAAGGTA
ATTCTGGGCAAGAACTGA
Transcript >OphauB2|1333
ATGTACGAGCTCTTCCTGACAGCGCTCGTAGAGCCAGGCGACTTGGAGGCGGCCTGCTCTGTGCTGGGCGGCCTG
TGTTCCATGACGCCATGGGAAACCATTAGCCGTGTTGTTTACTATCAAGGCCCTTCCAAGCCGACAGGCATCTCC
AACCAGACATCCATCGACAAGCCCATGCGCAAGGACACGGCGCTGCTGTGGAAAGATTTGCATCAGAACCTAAGT
CGCCAGTCCTACATACTTCAGGCCCGCTACGACGTCTCCAAACAAAGAGACATGGGTCCTCAGGCCGTGGCAATG
GATCTCAACAGCACGCCCGGCATCTTGCGTTGGACCGATTTTCCTGATCCGCCGCATGGTAGACCGCTTATTATA
CAGCGCAAGTTTGTTGATATCTGGGAGCAAAAGAAGCTGCCTTGTGTGATGCGCGATAATCAATACAGATACAAA
TCCGAAGTCATGGAGCAGCAATACCGCTTCTTCCGCGAAGAGACCGAGTTCTGCTTGACAAGGCAATATTTCCTA
GGCTCAATCAGCAACTACACACCGCTCGAGTCAAGGCAACACCAGTCTGAGCCCTTGGCAACGCTGCCTAGTTGG
GAGTCTTTGACGCCTGTTGACATGCAGAATCGATGGATTTTGCATGTCAAGGTGCACGTTCTTCAAGACAGCAAA
CCCGACGAACTGCGCAAAGCCCAGGATCAACTCACCGCCATCAAGACGGAGCTGGAAGGTGCCTTTGAGCTCAAA
GCCATTGACCGCAAGGCCCACGACACACGCGTGGCCTTGCAGCCCCAGGGCGTTCAAGCACTGCCCAACAAGGTA
ATTCTGGGCAAGAACTGA
Gene >OphauB2|1333
ATGTACGAGCTCTTCCTGACAGCGCTCGTAGAGCCAGGCGACTTGGAGGCGGCCTGCTCTGTGCTGGGCGGCCTG
TGTTCCATGACGCCATGGGAAACCATTAGCCGTGTTGTTTACTATCAAGGCCCTTCCAAGCCGACAGGCATCTCC
AACCAGACATCCATCGACAAGCCCATGCGCAAGGACACGGCGCTGCTGTGGAAAGATTTGCATCAGAACCTAAGT
CGCCAGTCCTACATACTTCAGGCCCGCTACGACGTCTCCAAACAAAGAGACATGGGTCCTCAGGCCGTGGCAATG
GATCTCAACAGCACGCCCGGCATCTTGCGTTGGACCGATTTTCCTGATCCGCCGCATGGTAGACCGCTTATTATA
CAGCGCAAGTTTGTTGATATCTGGGAGCAAAAGAAGCTGCCTTGTGTGATGCGCGATAATCAATACAGGTAGAGC
CGGCTCGCGTCTGGGCAGGCCATTTATTAACCATGCGCTCAGATACAAATCCGAAGTCATGGAGCAGCAATACCG
CTTCTTCCGCGAAGAGACCGAGTTCTGCTTGACAAGGCAATATTTCCTAGGCTCAATCAGCAACTACACACCGCT
CGAGTCAAGGCAACACCAGTCTGAGCCCTTGGCAACGCTGCCTAGTTGGGAGTCTTTGACGCCTGTTGACATGCA
GAATCGATGGATTTTGCATGTCAAGGTGCACGTTCTTCAAGACAGCAAACCCGACGAACTGCGCAAAGCCCAGGA
TCAACTCACCGCCATCAAGACGGAGCTGGAAGGTGCCTTTGAGCTCAAAGCCATTGACCGCAAGGCCCACGACAC
ACGCGTGGCCTTGCAGCCCCAGGGCGTTCAAGCACTGCCCAACAAGGTAATTCTGGGCAAGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail