Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1326
Gene name
LocationContig_132:25616..26255
Strand-
Gene length (bp)639
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 8.4E-38 12 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBR3|CHMP5_PONAB Charged multivesicular body protein 5 OS=Pongo abelii GN=CHMP5 PE=2 SV=1 1 173 1.0E-48
sp|Q9NZZ3|CHMP5_HUMAN Charged multivesicular body protein 5 OS=Homo sapiens GN=CHMP5 PE=1 SV=1 1 173 1.0E-48
sp|Q4QQV8|CHMP5_RAT Charged multivesicular body protein 5 OS=Rattus norvegicus GN=Chmp5 PE=2 SV=1 1 173 7.0E-48
sp|Q9D7S9|CHMP5_MOUSE Charged multivesicular body protein 5 OS=Mus musculus GN=Chmp5 PE=1 SV=1 1 173 7.0E-48
sp|Q9VVI9|CHMP5_DROME Charged multivesicular body protein 5 OS=Drosophila melanogaster GN=Vps60 PE=1 SV=2 1 173 6.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBR3|CHMP5_PONAB Charged multivesicular body protein 5 OS=Pongo abelii GN=CHMP5 PE=2 SV=1 1 173 1.0E-48
sp|Q9NZZ3|CHMP5_HUMAN Charged multivesicular body protein 5 OS=Homo sapiens GN=CHMP5 PE=1 SV=1 1 173 1.0E-48
sp|Q4QQV8|CHMP5_RAT Charged multivesicular body protein 5 OS=Rattus norvegicus GN=Chmp5 PE=2 SV=1 1 173 7.0E-48
sp|Q9D7S9|CHMP5_MOUSE Charged multivesicular body protein 5 OS=Mus musculus GN=Chmp5 PE=1 SV=1 1 173 7.0E-48
sp|Q9VVI9|CHMP5_DROME Charged multivesicular body protein 5 OS=Drosophila melanogaster GN=Vps60 PE=1 SV=2 1 173 6.0E-47
sp|Q6DD52|CHMP5_XENLA Charged multivesicular body protein 5 OS=Xenopus laevis GN=chmp5 PE=2 SV=1 1 166 6.0E-47
sp|Q5FW29|CHMP5_XENTR Charged multivesicular body protein 5 OS=Xenopus tropicalis GN=chmp5 PE=2 SV=1 1 166 5.0E-46
sp|Q54JK4|CHMP5_DICDI Charged multivesicular body protein 5 OS=Dictyostelium discoideum GN=chmp5 PE=3 SV=1 1 194 8.0E-46
sp|Q7T339|CHMP5_DANRE Charged multivesicular body protein 5 OS=Danio rerio GN=chmp5 PE=2 SV=1 1 166 6.0E-44
sp|Q03390|VPS60_YEAST Vacuolar protein-sorting-associated protein 60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS60 PE=1 SV=2 1 208 3.0E-38
sp|O74422|YQ56_SCHPO Uncharacterized protein C162.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.06c PE=3 SV=1 1 199 5.0E-33
sp|Q8IL52|YSNF1_PLAF7 Uncharacterized protein PF14_0397 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0397 PE=3 SV=2 15 167 2.0E-17
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 2 196 5.0E-09
sp|Q6FW96|SNF7_CANGA Vacuolar-sorting protein SNF7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF7 PE=3 SV=1 4 150 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1326
MNRLFGSKPTAPKPTLSGAITNIDTRVASIDTKLKALNGELSAYQEKLSRMRDGPGKQAIKQKALRVLQRRKAYE
AEKEKLESQVWNMEQAQSMQDNLKNVMTQVDAIKTTNKELKRQYGKIDLDRIERLQDEMADLMDVGNEIQDSLAR
SYDIPDDVDETELDAELEALGMEQEFESEMGGQLPGFLQDEVVPDFVDEPPETEDKVKQVAG*
Coding >OphauB2|1326
ATGAACCGACTTTTCGGCTCCAAGCCCACCGCTCCTAAACCGACACTTAGTGGTGCCATCACCAATATCGACACG
CGCGTCGCTTCCATTGATACCAAGCTCAAGGCTCTCAATGGCGAACTCTCGGCCTATCAGGAAAAGCTTTCACGG
ATGCGCGATGGACCCGGCAAGCAGGCCATTAAACAAAAGGCACTACGTGTTCTTCAACGCCGCAAGGCATACGAG
GCTGAAAAGGAGAAGCTAGAGAGTCAAGTGTGGAATATGGAACAGGCTCAGAGCATGCAGGACAATTTGAAAAAT
GTCATGACTCAAGTCGACGCCATCAAGACGACCAATAAGGAGCTCAAGCGCCAGTATGGCAAGATTGATCTCGAC
CGCATCGAGCGTCTTCAGGACGAAATGGCCGATCTTATGGACGTGGGCAACGAGATCCAAGACAGTCTGGCCCGC
AGCTACGATATTCCCGATGACGTGGACGAGACAGAACTCGACGCAGAACTCGAGGCTCTTGGAATGGAGCAAGAA
TTCGAAAGCGAAATGGGCGGCCAGTTGCCCGGTTTCCTCCAGGATGAAGTAGTGCCCGACTTTGTCGACGAGCCG
CCAGAGACCGAGGACAAGGTGAAGCAGGTGGCCGGGTAA
Transcript >OphauB2|1326
ATGAACCGACTTTTCGGCTCCAAGCCCACCGCTCCTAAACCGACACTTAGTGGTGCCATCACCAATATCGACACG
CGCGTCGCTTCCATTGATACCAAGCTCAAGGCTCTCAATGGCGAACTCTCGGCCTATCAGGAAAAGCTTTCACGG
ATGCGCGATGGACCCGGCAAGCAGGCCATTAAACAAAAGGCACTACGTGTTCTTCAACGCCGCAAGGCATACGAG
GCTGAAAAGGAGAAGCTAGAGAGTCAAGTGTGGAATATGGAACAGGCTCAGAGCATGCAGGACAATTTGAAAAAT
GTCATGACTCAAGTCGACGCCATCAAGACGACCAATAAGGAGCTCAAGCGCCAGTATGGCAAGATTGATCTCGAC
CGCATCGAGCGTCTTCAGGACGAAATGGCCGATCTTATGGACGTGGGCAACGAGATCCAAGACAGTCTGGCCCGC
AGCTACGATATTCCCGATGACGTGGACGAGACAGAACTCGACGCAGAACTCGAGGCTCTTGGAATGGAGCAAGAA
TTCGAAAGCGAAATGGGCGGCCAGTTGCCCGGTTTCCTCCAGGATGAAGTAGTGCCCGACTTTGTCGACGAGCCG
CCAGAGACCGAGGACAAGGTGAAGCAGGTGGCCGGGTAA
Gene >OphauB2|1326
ATGAACCGACTTTTCGGCTCCAAGCCCACCGCTCCTAAACCGACACTTAGTGGTGCCATCACCAATATCGACACG
CGCGTCGCTTCCATTGATACCAAGCTCAAGGCTCTCAATGGCGAACTCTCGGCCTATCAGGAAAAGCTTTCACGG
ATGCGCGATGGACCCGGCAAGCAGGCCATTAAACAAAAGGCACTACGTGTTCTTCAACGCCGCAAGGCATACGAG
GCTGAAAAGGAGAAGCTAGAGAGTCAAGTGTGGAATATGGAACAGGCTCAGAGCATGCAGGACAATTTGAAAAAT
GTCATGACTCAAGTCGACGCCATCAAGACGACCAATAAGGAGCTCAAGCGCCAGTATGGCAAGATTGATCTCGAC
CGCATCGAGCGTCTTCAGGACGAAATGGCCGATCTTATGGACGTGGGCAACGAGATCCAAGACAGTCTGGCCCGC
AGCTACGATATTCCCGATGACGTGGACGAGACAGAACTCGACGCAGAACTCGAGGCTCTTGGAATGGAGCAAGAA
TTCGAAAGCGAAATGGGCGGCCAGTTGCCCGGTTTCCTCCAGGATGAAGTAGTGCCCGACTTTGTCGACGAGCCG
CCAGAGACCGAGGACAAGGTGAAGCAGGTGGCCGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail