Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1325
Gene name
LocationContig_132:22188..25194
Strand+
Gene length (bp)3006
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 3.0E-04 332 361
PF00400 WD40 WD domain, G-beta repeat 2.9E-02 372 406
PF00400 WD40 WD domain, G-beta repeat 2.3E-01 489 524
PF12937 F-box-like F-box-like 2.1E-14 88 132
PF00646 F-box F-box domain 1.9E-08 89 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 294 545 2.0E-36
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 251 634 5.0E-36
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 294 634 1.0E-35
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 251 634 1.0E-35
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 294 545 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 294 545 2.0E-36
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 251 634 5.0E-36
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 294 634 1.0E-35
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 251 634 1.0E-35
sp|Q91854|TRCB_XENLA Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 294 545 1.0E-35
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 298 545 4.0E-35
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 310 634 2.0E-34
sp|Q00659|SCONB_EMENI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 290 634 1.0E-22
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 300 544 3.0E-22
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 300 544 3.0E-22
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 300 568 4.0E-22
sp|Q4X0A9|SCONB_ASPFU Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 290 642 7.0E-22
sp|B0XTS1|SCONB_ASPFC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 290 642 7.0E-22
sp|A1C7E4|SCONB_ASPCL Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 300 634 1.0E-21
sp|Q2UFN8|SCONB_ASPOR Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 300 634 2.0E-21
sp|B8NGT5|SCONB_ASPFN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 300 634 2.0E-21
sp|P87053|POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 300 546 4.0E-21
sp|Q0CY32|SCONB_ASPTN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 300 634 6.0E-21
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 300 545 7.0E-21
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 300 545 1.0E-20
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 300 545 1.0E-20
sp|A2QCU8|SCONB_ASPNC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 290 642 2.0E-20
sp|A1DHW6|SCONB_NEOFI Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 290 642 2.0E-20
sp|B6GZA1|SCONB_PENRW Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 46 683 3.0E-20
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 263 497 2.0E-19
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 324 544 2.0E-18
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 300 497 4.0E-18
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 300 541 5.0E-18
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 344 541 7.0E-18
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 344 541 7.0E-18
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 344 541 7.0E-18
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 344 541 7.0E-18
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 344 541 7.0E-18
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 332 544 4.0E-17
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 300 634 2.0E-16
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 344 541 3.0E-16
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 344 541 7.0E-16
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 344 541 1.0E-15
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 314 524 2.0E-15
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 344 541 2.0E-15
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 344 541 4.0E-15
sp|Q9VZF4|FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 328 440 6.0E-15
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 320 546 9.0E-15
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 324 545 1.0E-14
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 328 440 3.0E-14
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 328 440 3.0E-14
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 332 544 4.0E-14
sp|D4D8P3|SCONB_TRIVH Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 366 580 5.0E-14
sp|D4AM37|SCONB_ARTBC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 374 580 5.0E-14
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 328 440 6.0E-14
sp|C5FP68|SCONB_ARTOC Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 374 580 7.0E-14
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 318 547 1.0E-13
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 318 547 1.0E-13
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 328 517 1.0E-13
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 332 544 2.0E-13
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 333 544 3.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 332 544 3.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 328 544 3.0E-13
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 328 534 3.0E-13
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 333 544 7.0E-13
sp|Q61FW2|SEL10_CAEBR F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 333 544 1.0E-12
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 332 545 1.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 332 544 2.0E-12
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 328 544 3.0E-12
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 327 545 3.0E-12
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 353 577 3.0E-12
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 315 539 4.0E-12
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 344 544 1.0E-11
sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 318 535 1.0E-11
sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 318 535 1.0E-11
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 301 545 2.0E-11
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 369 634 2.0E-11
sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 318 535 2.0E-11
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 329 560 3.0E-11
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 312 544 4.0E-11
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 332 579 4.0E-11
sp|Q54S79|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 312 528 4.0E-11
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 325 545 5.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 328 544 6.0E-11
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 328 537 6.0E-11
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 332 544 6.0E-11
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 329 544 7.0E-11
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 344 538 7.0E-11
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 332 527 7.0E-11
sp|B6Q4Z5|SCONB_TALMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 374 580 8.0E-11
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 344 541 9.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 344 544 1.0E-10
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 328 544 1.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 315 560 1.0E-10
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 305 544 1.0E-10
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 332 544 1.0E-10
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 332 544 1.0E-10
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 328 537 1.0E-10
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 305 544 1.0E-10
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 305 544 1.0E-10
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 374 580 2.0E-10
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 344 544 2.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 332 541 2.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 328 544 2.0E-10
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 328 535 2.0E-10
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 329 549 2.0E-10
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 326 551 2.0E-10
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 325 545 2.0E-10
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 344 549 3.0E-10
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 328 544 3.0E-10
sp|Q6CB13|MDV1_YARLI Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 332 528 4.0E-10
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 322 529 5.0E-10
sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 333 527 5.0E-10
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 322 453 5.0E-10
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 315 539 5.0E-10
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 332 545 7.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 315 539 7.0E-10
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 344 544 7.0E-10
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 344 544 7.0E-10
sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 333 527 8.0E-10
sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 333 544 8.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 332 528 1.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 315 539 1.0E-09
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 329 549 1.0E-09
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 315 539 1.0E-09
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 326 496 1.0E-09
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 344 549 2.0E-09
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 332 506 2.0E-09
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 326 496 2.0E-09
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 325 544 2.0E-09
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 326 496 2.0E-09
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 326 496 2.0E-09
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 326 496 2.0E-09
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 326 496 2.0E-09
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 344 544 2.0E-09
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 326 496 2.0E-09
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 332 517 3.0E-09
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 332 544 3.0E-09
sp|P42527|MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 297 527 3.0E-09
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 333 529 3.0E-09
sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 328 530 3.0E-09
sp|Q1DIW7|MDV1_COCIM Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 343 484 3.0E-09
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 344 544 3.0E-09
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 333 557 4.0E-09
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 326 496 5.0E-09
sp|P07834|CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 333 524 5.0E-09
sp|P0CS44|MDV1_CRYNJ Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 321 441 5.0E-09
sp|P0CS45|MDV1_CRYNB Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 321 441 5.0E-09
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 332 634 6.0E-09
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 333 529 7.0E-09
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 372 544 7.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 332 634 8.0E-09
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 332 634 9.0E-09
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 332 517 1.0E-08
sp|A8PTE4|MDV1_MALGO Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 322 484 1.0E-08
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 332 544 1.0E-08
sp|O14170|POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 328 528 1.0E-08
sp|Q5SUS0|FBW10_MOUSE F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 321 517 1.0E-08
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 333 440 1.0E-08
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 333 440 1.0E-08
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 348 634 2.0E-08
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 333 517 2.0E-08
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 333 541 2.0E-08
sp|A2R3Z3|MDV1_ASPNC Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 316 476 2.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 328 544 2.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 333 541 2.0E-08
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 369 634 2.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 332 544 2.0E-08
sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 316 530 2.0E-08
sp|Q7S8R5|MDV1_NEUCR Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 332 484 2.0E-08
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 334 541 3.0E-08
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 334 541 3.0E-08
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 324 542 3.0E-08
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 316 416 3.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 314 544 3.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 288 442 3.0E-08
sp|Q0CJD8|MDV1_ASPTN Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 343 476 3.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 344 544 4.0E-08
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 332 534 4.0E-08
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 324 494 5.0E-08
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 332 544 5.0E-08
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 332 544 5.0E-08
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 332 544 5.0E-08
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 332 544 5.0E-08
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 332 544 6.0E-08
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 332 544 6.0E-08
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 332 544 6.0E-08
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 333 544 6.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 314 507 8.0E-08
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 334 541 8.0E-08
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 332 544 8.0E-08
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 333 544 8.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 288 442 8.0E-08
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 333 431 8.0E-08
sp|Q6GMD2|WDR61_XENLA WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 331 544 8.0E-08
sp|Q4WVS4|MDV1_ASPFU Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 343 476 8.0E-08
sp|A1DDL6|MDV1_NEOFI Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 343 476 9.0E-08
sp|Q4P8R5|MDV1_USTMA Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 334 528 1.0E-07
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 333 528 1.0E-07
sp|Q2U5Z8|MDV1_ASPOR Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 343 476 1.0E-07
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 325 440 1.0E-07
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 332 544 1.0E-07
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 332 544 1.0E-07
sp|A1CBP8|MDV1_ASPCL Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 343 476 1.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 333 545 1.0E-07
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 369 634 1.0E-07
sp|Q2GT28|LIS12_CHAGB Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 327 542 1.0E-07
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 346 676 1.0E-07
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 324 544 1.0E-07
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 56 149 2.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 333 544 2.0E-07
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 324 544 2.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 332 544 2.0E-07
sp|P38011|GBLP_YEAST Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 307 499 2.0E-07
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 314 544 2.0E-07
sp|Q6TNS2|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1 327 550 2.0E-07
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 331 544 2.0E-07
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 332 544 2.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 324 542 3.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 324 542 3.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 324 542 3.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 324 542 3.0E-07
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 325 544 3.0E-07
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 340 495 3.0E-07
sp|A7ETB3|MDV1_SCLS1 Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 343 484 3.0E-07
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 332 524 3.0E-07
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 369 545 4.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 324 542 4.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 324 542 4.0E-07
sp|Q4WT34|PRP46_ASPFU Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 333 534 4.0E-07
sp|Q5AXW3|MDV1_EMENI Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 343 476 4.0E-07
sp|Q9P7I3|MDV1_SCHPO Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 332 555 4.0E-07
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 324 544 4.0E-07
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 324 544 4.0E-07
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 324 544 4.0E-07
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 324 544 4.0E-07
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 324 544 4.0E-07
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 325 507 4.0E-07
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 332 529 4.0E-07
sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 346 537 5.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 324 542 5.0E-07
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 324 544 5.0E-07
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 369 545 5.0E-07
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 334 481 5.0E-07
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 328 442 6.0E-07
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 324 542 6.0E-07
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 324 544 6.0E-07
sp|Q6Q0C0|TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 316 541 6.0E-07
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 324 542 6.0E-07
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 324 542 6.0E-07
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 332 544 7.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 332 544 7.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 345 534 7.0E-07
sp|Q758R7|MDV1_ASHGO Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 348 483 7.0E-07
sp|Q7ZVA0|SMU1_DANRE WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 326 496 7.0E-07
sp|B8PD53|LIS12_POSPM Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 369 544 7.0E-07
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 324 544 7.0E-07
sp|Q6CJ50|MDV1_KLULA Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 328 528 8.0E-07
sp|Q0U2T3|MDV1_PHANO Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 343 445 8.0E-07
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 332 544 8.0E-07
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 334 408 8.0E-07
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 324 544 8.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 324 545 9.0E-07
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 333 445 9.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 332 544 9.0E-07
sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 46 131 1.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 333 528 1.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 321 497 1.0E-06
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 324 545 1.0E-06
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 346 634 1.0E-06
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 346 634 1.0E-06
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 344 538 1.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 344 534 1.0E-06
sp|P53699|CDC4_CANAX Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 303 551 1.0E-06
sp|Q2H139|MDV1_CHAGB Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 336 484 1.0E-06
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 332 442 2.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 347 445 2.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 324 542 2.0E-06
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 324 542 2.0E-06
sp|A4RJV3|MDV1_MAGO7 Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 343 484 2.0E-06
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 346 634 2.0E-06
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 346 634 2.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 332 544 2.0E-06
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 346 634 2.0E-06
sp|Q0D0X6|LIS1_ASPTN Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 313 542 2.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 344 534 2.0E-06
sp|Q9C1X1|PWP2_SCHPO Periodic tryptophan protein 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.04c PE=1 SV=1 345 614 2.0E-06
sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 328 535 3.0E-06
sp|Q8C4J7|TBL3_MOUSE Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 333 515 3.0E-06
sp|Q39336|GBLP_BRANA Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 344 538 3.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 332 537 3.0E-06
sp|Q3ULA2|FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 332 407 4.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 332 544 4.0E-06
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 273 443 4.0E-06
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 321 441 4.0E-06
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 328 516 5.0E-06
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 338 541 6.0E-06
sp|Q9Y297|FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 332 407 7.0E-06
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 332 407 7.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 332 407 7.0E-06
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 332 520 7.0E-06
sp|Q01277|SCONB_NEUCR Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 299 412 8.0E-06
sp|Q75LV5|YAO_ORYSJ U3 snoRNP-associated protein-like YAOH OS=Oryza sativa subsp. japonica GN=Os03g0625900 PE=2 SV=1 327 561 8.0E-06
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 273 443 9.0E-06
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 273 443 9.0E-06
sp|P39014|MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 333 536 1.0E-05
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 273 443 1.0E-05
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 334 544 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1325
MDPFSPAHQTDEGYSEDPFTLSMHQNPVMAGPSFKSPADLPAWLASTASALPLSIKMDMTMALLEQLPTSVLADI
VQRLRPRLYLDFIQHLPPEICLKILGYLDPISLVCVMQTCRSWYKLVLDPKLWERLYHLEGWKAIQSEIDIWEAR
VNEGLHKSIDHLRRLHNAETHTSGLDTLGNEDDGDLEMVDVDCCESWTADQSANVGGSIFGNPKSSLPTLSVGSR
PQEAVASLGAVLEKGKEVDRGSRQQERRVRAKRKEPGSSPQRASAHALRANSPDNLLRSTLWIWDASRSGYRINW
KHLYNMRQRLESNWELGKYTTFQLPHPLYPEEGHQECIYTLQFDANYLVSGSRDQSLRIWDMHSHRLVRPPLLGH
KGSVLCLQFDADPAEDILVSGSSDSDIFIWKFSTGQVVQRITDAHRESVLNVRFDKRILVTSSKDKVNPVPVTLK
RYGYEPDLGQELLFKEPFRLIGRLDGDRQIKIWNWPDQVCLRTIPAHDKGIACVEFDERRIVSGSSDFEVCIFDA
PTGLKVAQLRGHTNLVRTVQAGFGDLPNSREEDEAEAKAVDADYFRAIEAGEVNQDSDRRARRSRPVNAGSSRPT
EIQAFGAKVPPGGGGSRKYGRIVSGSYDHTIIIWRRDKEGVWKPAHHLRQEEAAAAAQRRVAPPEEPSTPQTSAE
SHVAQANAAFSSSSAAGPGVSQENAAVHSSGDGTGASHASPGLYVALIEQVVPLGAIALEQALLSYPGMLAYLGV
LQTAIEREPSPVTSLQHGAFMPSSVVAAAAAVAAGGPRSWIDAGGSGSNVAEASVSAMAPESMATPAPIAAPVPA
PAQPAHHHPPLIPTQEQLPAQEQPNAHATQHHPHLAAAENSAARIFKLQFDARKIICCSQMSVIVGWDFCNEEPE
LEAASRFFATVD*
Coding >OphauB2|1325
ATGGACCCCTTCTCGCCTGCACATCAGACCGACGAAGGCTACTCCGAGGATCCCTTTACACTATCGATGCACCAA
AATCCCGTCATGGCAGGGCCGTCATTCAAATCCCCCGCCGACCTGCCGGCATGGCTAGCCAGCACCGCATCCGCT
CTTCCTTTATCTATCAAGATGGACATGACAATGGCTTTGCTTGAGCAGTTACCGACATCGGTGCTGGCTGATATT
GTTCAACGCCTGAGACCAAGATTGTACCTCGATTTCATTCAACATTTACCGCCTGAAATATGCCTCAAGATTCTC
GGCTATCTCGACCCCATCTCTCTTGTCTGTGTCATGCAGACATGTCGTTCGTGGTACAAACTTGTCTTGGACCCC
AAACTTTGGGAGAGGTTATACCACCTTGAAGGATGGAAGGCTATCCAGTCAGAGATAGATATTTGGGAAGCCAGA
GTCAATGAAGGGCTGCACAAGTCGATTGACCATCTACGACGCTTACACAATGCTGAGACGCACACCAGCGGTTTG
GATACCCTTGGAAACGAAGACGATGGAGATCTTGAAATGGTTGATGTGGATTGCTGCGAATCTTGGACGGCAGAC
CAGAGTGCTAATGTGGGAGGTAGCATTTTTGGCAATCCAAAGTCATCACTTCCTACCCTTTCAGTCGGTTCAAGA
CCCCAAGAGGCCGTCGCCAGTCTTGGAGCAGTATTAGAAAAGGGAAAGGAGGTTGACAGAGGCTCTAGACAACAG
GAGCGTCGAGTGCGTGCCAAGCGAAAGGAGCCGGGTAGTTCACCGCAGCGTGCCTCGGCCCATGCTCTACGTGCT
AACAGCCCAGACAACCTTTTGAGATCAACATTGTGGATCTGGGATGCCAGTCGGTCGGGCTATCGCATCAATTGG
AAGCATCTCTACAACATGAGGCAACGCCTCGAATCGAATTGGGAGCTTGGAAAATATACCACTTTCCAGCTGCCG
CACCCGCTATATCCTGAAGAGGGCCATCAAGAATGTATCTATACGCTGCAATTTGACGCCAACTACCTTGTGAGC
GGCAGTCGAGACCAGTCTCTGCGCATATGGGATATGCATTCCCACCGCCTCGTTCGTCCGCCACTTCTAGGCCAC
AAAGGGTCAGTCTTGTGTCTACAATTCGATGCAGATCCAGCCGAGGACATACTAGTATCAGGAAGTAGCGATTCT
GATATCTTTATTTGGAAATTTTCTACCGGACAAGTGGTACAAAGAATCACCGATGCTCATCGAGAATCTGTCTTG
AATGTCCGATTCGACAAGCGCATCCTTGTCACCTCATCCAAGGATAAAGTCAATCCCGTGCCTGTTACGTTGAAG
CGCTATGGATACGAGCCAGACCTTGGGCAAGAACTGCTTTTCAAAGAGCCTTTTCGCCTGATAGGCCGGCTCGAT
GGTGATCGGCAAATCAAGATTTGGAACTGGCCCGATCAAGTCTGCCTTCGAACTATTCCCGCTCACGACAAGGGT
ATAGCCTGTGTCGAATTTGATGAGCGTCGAATAGTGAGCGGAAGTAGCGACTTTGAGGTGTGCATATTTGATGCC
CCCACAGGACTCAAGGTGGCCCAGCTTCGAGGCCACACCAACCTAGTTCGGACAGTCCAGGCAGGCTTCGGCGAC
CTGCCGAATAGCAGAGAGGAGGATGAGGCAGAGGCTAAAGCAGTCGATGCCGACTACTTTCGAGCCATTGAGGCA
GGAGAGGTTAACCAGGATAGCGATCGCCGAGCCAGGCGCTCCAGGCCAGTCAATGCGGGCAGTTCCAGGCCGACA
GAAATACAAGCCTTTGGGGCCAAAGTTCCGCCTGGAGGGGGAGGGAGCAGAAAATACGGACGCATCGTGTCCGGT
TCTTATGACCACACCATCATCATTTGGCGGCGCGATAAGGAGGGGGTGTGGAAGCCGGCTCATCATTTACGCCAA
GAAGAGGCTGCTGCTGCTGCGCAACGCAGAGTGGCGCCCCCAGAAGAGCCGTCAACACCTCAAACTTCTGCTGAA
TCCCATGTCGCGCAAGCAAACGCAGCCTTCTCATCTTCGAGTGCCGCTGGGCCCGGTGTCAGCCAGGAGAATGCG
GCTGTTCACTCGTCTGGAGATGGCACAGGCGCCTCGCATGCCTCGCCGGGTCTTTATGTGGCTCTGATTGAGCAG
GTTGTTCCCCTAGGCGCAATAGCTCTGGAGCAAGCCTTGCTGAGCTATCCTGGCATGCTCGCCTACCTTGGTGTG
TTGCAGACTGCTATCGAGCGTGAACCGTCTCCCGTGACCTCTCTTCAACACGGCGCCTTTATGCCAAGCTCTGTT
GTAGCAGCAGCAGCAGCAGTAGCTGCAGGTGGTCCCAGATCTTGGATAGACGCTGGTGGTTCTGGCTCAAACGTT
GCCGAGGCGTCTGTGTCGGCGATGGCTCCTGAGTCAATGGCGACACCTGCTCCTATTGCAGCACCTGTCCCTGCT
CCAGCCCAGCCAGCTCACCATCATCCCCCGCTAATTCCTACCCAGGAGCAACTCCCTGCTCAAGAGCAACCCAAT
GCCCATGCAACTCAACACCACCCACACCTTGCTGCAGCTGAGAACTCGGCCGCGCGCATCTTCAAATTACAATTC
GATGCGCGCAAAATCATTTGCTGCAGCCAAATGTCAGTGATTGTGGGCTGGGACTTTTGCAACGAAGAACCAGAG
TTGGAGGCAGCCTCTCGTTTCTTTGCAACTGTCGACTAG
Transcript >OphauB2|1325
ATGGACCCCTTCTCGCCTGCACATCAGACCGACGAAGGCTACTCCGAGGATCCCTTTACACTATCGATGCACCAA
AATCCCGTCATGGCAGGGCCGTCATTCAAATCCCCCGCCGACCTGCCGGCATGGCTAGCCAGCACCGCATCCGCT
CTTCCTTTATCTATCAAGATGGACATGACAATGGCTTTGCTTGAGCAGTTACCGACATCGGTGCTGGCTGATATT
GTTCAACGCCTGAGACCAAGATTGTACCTCGATTTCATTCAACATTTACCGCCTGAAATATGCCTCAAGATTCTC
GGCTATCTCGACCCCATCTCTCTTGTCTGTGTCATGCAGACATGTCGTTCGTGGTACAAACTTGTCTTGGACCCC
AAACTTTGGGAGAGGTTATACCACCTTGAAGGATGGAAGGCTATCCAGTCAGAGATAGATATTTGGGAAGCCAGA
GTCAATGAAGGGCTGCACAAGTCGATTGACCATCTACGACGCTTACACAATGCTGAGACGCACACCAGCGGTTTG
GATACCCTTGGAAACGAAGACGATGGAGATCTTGAAATGGTTGATGTGGATTGCTGCGAATCTTGGACGGCAGAC
CAGAGTGCTAATGTGGGAGGTAGCATTTTTGGCAATCCAAAGTCATCACTTCCTACCCTTTCAGTCGGTTCAAGA
CCCCAAGAGGCCGTCGCCAGTCTTGGAGCAGTATTAGAAAAGGGAAAGGAGGTTGACAGAGGCTCTAGACAACAG
GAGCGTCGAGTGCGTGCCAAGCGAAAGGAGCCGGGTAGTTCACCGCAGCGTGCCTCGGCCCATGCTCTACGTGCT
AACAGCCCAGACAACCTTTTGAGATCAACATTGTGGATCTGGGATGCCAGTCGGTCGGGCTATCGCATCAATTGG
AAGCATCTCTACAACATGAGGCAACGCCTCGAATCGAATTGGGAGCTTGGAAAATATACCACTTTCCAGCTGCCG
CACCCGCTATATCCTGAAGAGGGCCATCAAGAATGTATCTATACGCTGCAATTTGACGCCAACTACCTTGTGAGC
GGCAGTCGAGACCAGTCTCTGCGCATATGGGATATGCATTCCCACCGCCTCGTTCGTCCGCCACTTCTAGGCCAC
AAAGGGTCAGTCTTGTGTCTACAATTCGATGCAGATCCAGCCGAGGACATACTAGTATCAGGAAGTAGCGATTCT
GATATCTTTATTTGGAAATTTTCTACCGGACAAGTGGTACAAAGAATCACCGATGCTCATCGAGAATCTGTCTTG
AATGTCCGATTCGACAAGCGCATCCTTGTCACCTCATCCAAGGATAAAGTCAATCCCGTGCCTGTTACGTTGAAG
CGCTATGGATACGAGCCAGACCTTGGGCAAGAACTGCTTTTCAAAGAGCCTTTTCGCCTGATAGGCCGGCTCGAT
GGTGATCGGCAAATCAAGATTTGGAACTGGCCCGATCAAGTCTGCCTTCGAACTATTCCCGCTCACGACAAGGGT
ATAGCCTGTGTCGAATTTGATGAGCGTCGAATAGTGAGCGGAAGTAGCGACTTTGAGGTGTGCATATTTGATGCC
CCCACAGGACTCAAGGTGGCCCAGCTTCGAGGCCACACCAACCTAGTTCGGACAGTCCAGGCAGGCTTCGGCGAC
CTGCCGAATAGCAGAGAGGAGGATGAGGCAGAGGCTAAAGCAGTCGATGCCGACTACTTTCGAGCCATTGAGGCA
GGAGAGGTTAACCAGGATAGCGATCGCCGAGCCAGGCGCTCCAGGCCAGTCAATGCGGGCAGTTCCAGGCCGACA
GAAATACAAGCCTTTGGGGCCAAAGTTCCGCCTGGAGGGGGAGGGAGCAGAAAATACGGACGCATCGTGTCCGGT
TCTTATGACCACACCATCATCATTTGGCGGCGCGATAAGGAGGGGGTGTGGAAGCCGGCTCATCATTTACGCCAA
GAAGAGGCTGCTGCTGCTGCGCAACGCAGAGTGGCGCCCCCAGAAGAGCCGTCAACACCTCAAACTTCTGCTGAA
TCCCATGTCGCGCAAGCAAACGCAGCCTTCTCATCTTCGAGTGCCGCTGGGCCCGGTGTCAGCCAGGAGAATGCG
GCTGTTCACTCGTCTGGAGATGGCACAGGCGCCTCGCATGCCTCGCCGGGTCTTTATGTGGCTCTGATTGAGCAG
GTTGTTCCCCTAGGCGCAATAGCTCTGGAGCAAGCCTTGCTGAGCTATCCTGGCATGCTCGCCTACCTTGGTGTG
TTGCAGACTGCTATCGAGCGTGAACCGTCTCCCGTGACCTCTCTTCAACACGGCGCCTTTATGCCAAGCTCTGTT
GTAGCAGCAGCAGCAGCAGTAGCTGCAGGTGGTCCCAGATCTTGGATAGACGCTGGTGGTTCTGGCTCAAACGTT
GCCGAGGCGTCTGTGTCGGCGATGGCTCCTGAGTCAATGGCGACACCTGCTCCTATTGCAGCACCTGTCCCTGCT
CCAGCCCAGCCAGCTCACCATCATCCCCCGCTAATTCCTACCCAGGAGCAACTCCCTGCTCAAGAGCAACCCAAT
GCCCATGCAACTCAACACCACCCACACCTTGCTGCAGCTGAGAACTCGGCCGCGCGCATCTTCAAATTACAATTC
GATGCGCGCAAAATCATTTGCTGCAGCCAAATGTCAGTGATTGTGGGCTGGGACTTTTGCAACGAAGAACCAGAG
TTGGAGGCAGCCTCTCGTTTCTTTGCAACTGTCGACTAG
Gene >OphauB2|1325
ATGGACCCCTTCTCGCCTGCACATCAGACCGACGAAGGCTACTCCGAGGATCCCTTTACACTATCGATGCACCAA
AATCCCGTCATGGCAGGGCCGTCATTCAAATCCCCCGCCGACCTGCCGGCATGGCTAGCCAGCACCGCATCCGCT
CTTCCTTTATCTATCAAGATGGGTGAGCGATTGCTGCAGCCTGGCCACCGTTATGCAGTTAGCTGACCAAAGAGC
TTCGTAGACATGACAATGGCTTTGCTTGAGCAGTTACCGACATCGGTGCTGGCTGATATTGTTCAACGCCTGAGA
CCAAGATTGTACCTCGATTTCATTCAACATTTACCGCCTGAAATATGCCTCAAGATTCTCGGCTATCTCGACCCC
ATCTCTCTTGTCTGTGTCATGCAGACATGTCGTTCGTGGTACAAACTTGTCTTGGACCCCAAACTTTGGGAGAGG
TTATACCACCTTGAAGGATGGAAGGCTATCCAGTCAGAGATAGATATTTGGGAAGCCAGAGTCAATGAAGGGCTG
CACAAGTCGATTGACCATCTACGACGCTTACACAATGCTGAGACGCACACCAGCGGTTTGGATACCCTTGGAAAC
GAAGACGATGGAGATCTTGAAATGGTTGATGTGGATTGCTGCGAATCTTGGACGGCAGACCAGAGTGCTAATGTG
GGAGGTAGCATTTTTGGCAATCCAAAGTCATCACTTCCTACCCTTTCAGTCGGTTCAAGACCCCAAGAGGCCGTC
GCCAGTCTTGGAGCAGTATTAGAAAAGGGAAAGGAGGTTGACAGAGGCTCTAGACAACAGGAGCGTCGAGTGCGT
GCCAAGCGAAAGGAGCCGGGTAGTTCACCGCAGCGTGCCTCGGCCCATGCTCTACGTGCTAACAGCCCAGACAAC
CTTTTGAGATCAACATTGTGGATCTGGGATGCCAGTCGGTCGGGCTATCGCATCAATTGGAAGCATCTCTACAAC
ATGAGGCAACGCCTCGAATCGAATTGGGAGCTTGGAAAATATACCACTTTCCAGCTGCCGCACCCGCTATATCCT
GAAGAGGGCCATCAAGAATGTATCTATACGCTGCAATTTGACGCCAACTACCTTGTGAGCGGCAGTCGAGACCAG
TCTCTGCGCATATGGGATATGCATTCCCACCGCCTCGTTCGTCCGCCACTTCTAGGCCACAAAGGGTCAGTCTTG
TGTCTACAATTCGATGCAGATCCAGCCGAGGACATACTAGTATCAGGAAGTAGCGATTCTGATATCTTTATTTGG
AAATTTTCTACCGGACAAGTGGTACAAAGAATCACCGATGCTCATCGAGAATCTGTCTTGAATGTCCGATTCGAC
AAGCGCATCCTTGTCACCTCATCCAAGGATAAGTCGGTCAAAATCTTTACTCGGCGGCCGCTTCGGTGCGGAGAA
GTGGAACACGGAGTCGACCATGACAGAGTCAATCCCGTGCCTGTTACGTTGAAGCGCTATGGATACGAGCCAGAC
CTTGGGCAAGAACTGCTTTTCAAAGAGCCTTTTCGCCTGATAGGCCGGCTCGATGGTCATGGAGCGGCTGTCAAT
GCGATCCAGGTGCGAGATTGTACTGTTGTGTCTGTTTCAGGTGATCGGCAAATCAAGATTTGGAACTGGCCCGAT
CAAGTCTGCCTTCGAACTATTCCCGCTCACGACAAGGGTATAGCCTGTGTCGAATTTGATGAGCGTCGAATAGTG
AGCGGAAGTAGCGACTTTGAGGTGTGCATATTTGATGCCCCCACAGGACTCAAGGTGGCCCAGCTTCGAGGCCAC
ACCAACCTAGTTCGGACAGTCCAGGCAGGCTTCGGCGACCTGCCGAATAGCAGAGAGGAGGATGAGGCAGAGGCT
AAAGCAGTCGATGCCGACTACTTTCGAGCCATTGAGGCAGGAGAGGTTAACCAGGATAGCGATCGCCGAGCCAGG
CGCTCCAGGCCAGTCAATGCGGGCAGTTCCAGGCCGACAGAAATACAAGCCTTTGGGGCCAAAGTTCCGCCTGGA
GGGGGAGGGAGCAGAAAATACGGACGCATCGTGTCCGGTTCTTATGACCACACCATCATCATTTGGCGGCGCGAT
AAGGAGGGGGTGTGGAAGCCGGCTCATCATTTACGCCAAGAAGAGGCTGCTGCTGCTGCGCAACGCAGAGTGGCG
CCCCCAGAAGAGCCGTCAACACCTCAAACTTCTGCTGAATCCCATGTCGCGCAAGCAAACGCAGCCTTCTCATCT
TCGAGTGCCGCTGGGCCCGGTGTCAGCCAGGAGAATGCGGCTGTTCACTCGTCTGGAGATGGCACAGGCGCCTCG
CATGCCTCGCCGGGTCTTTATGTGGCTCTGATTGAGCAGGTTGTTCCCCTAGGCGCAATAGCTCTGGAGCAAGCC
TTGCTGAGCTATCCTGGCATGCTCGCCTACCTTGGTGTGTTGCAGACTGCTATCGAGCGTGAACCGTCTCCCGTG
GTCCGTGCCCAGCTCAGACAGGCCGTGGCAAATGCCCTAGTGGTTGTTGAAGCTAGTCAAGCAGCAAGAGCACGA
CAGACCTCTCTTCAACACGGCGCCTTTATGCCAAGCTCTGTTGTAGCAGCAGCAGCAGCAGTAGCTGCAGGTGGT
CCCAGATCTTGGATAGACGCTGGTGGTTCTGGCTCAAACGTTGCCGAGGCGTCTGTGTCGGCGATGGCTCCTGAG
TCAATGGCGACACCTGCTCCTATTGCAGCACCTGTCCCTGCTCCAGCCCAGCCAGCTCACCATCATCCCCCGCTA
ATTCCTACCCAGGAGCAACTCCCTGCTCAAGAGCAACCCAATGCCCATGCAACTCAACACCACCCACACCTTGCT
GCAGCTGAGAACTCGGCCGCGCGCATCTTCAAATTACAATTCGATGCGCGCAAAATCATTTGCTGCAGCCAAATG
TCAGTGATTGTGGGCTGGGACTTTTGCAACGAAGAACCAGAGTTGGAGGCAGCCTCTCGTTTCTTTGCAACTGTC
GACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail