Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1321
Gene name
LocationContig_132:10749..11497
Strand-
Gene length (bp)748
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08432 Vfa1 AAA-ATPase Vps4-associated protein 1 2.8E-53 7 190

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V9|YNH1_SCHPO UPF0589 protein C32H8.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC32H8.01c PE=3 SV=1 1 69 2.0E-13
sp|P40080|VFA1_YEAST VPS4-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VFA1 PE=1 SV=1 7 189 9.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1321
MAPPFPNIYTHRKVADAAAKSCDICYKPSTSVLITPDQKDFFYVCTIHLKDTHFCTPKIDHEAIKAKRERELAAE
VELVKKEYEERLRRNKEKEANLEKNRGKEHDKEPDKDEDKDKKEEKEKNKMTADEKEPGQEIKTEATAPDEEESR
VFELKSAFYQQRLGRKRQLEAAKKDRERASQSNYFPSVPNNLPGK*
Coding >OphauB2|1321
ATGGCGCCTCCTTTTCCAAACATTTACACACATCGCAAGGTGGCAGATGCTGCAGCCAAGTCATGCGACATCTGC
TATAAGCCCAGCACGTCGGTGCTCATTACGCCAGATCAAAAGGACTTCTTTTATGTCTGCACCATTCACCTCAAA
GATACTCACTTTTGCACTCCAAAAATTGATCATGAAGCTATCAAGGCGAAACGGGAGCGGGAGCTGGCAGCCGAG
GTGGAATTGGTGAAGAAGGAATACGAAGAACGGCTGCGTCGCAACAAGGAAAAAGAGGCCAACTTGGAAAAGAAC
CGAGGCAAAGAACATGACAAGGAACCGGACAAGGACGAAGACAAGGACAAGAAAGAGGAAAAGGAAAAGAATAAA
ATGACTGCAGACGAAAAAGAGCCCGGCCAAGAGATCAAGACAGAGGCCACGGCGCCTGATGAAGAAGAGTCCAGA
GTCTTTGAGCTCAAGAGCGCATTCTATCAGCAGCGACTTGGTAGAAAACGTCAGCTTGAAGCTGCCAAGAAAGAT
CGGGAAAGAGCTTCACAGTCCAACTACTTTCCCTCTGTTCCAAACAACTTGCCGGGTAAGTGA
Transcript >OphauB2|1321
ATGGCGCCTCCTTTTCCAAACATTTACACACATCGCAAGGTGGCAGATGCTGCAGCCAAGTCATGCGACATCTGC
TATAAGCCCAGCACGTCGGTGCTCATTACGCCAGATCAAAAGGACTTCTTTTATGTCTGCACCATTCACCTCAAA
GATACTCACTTTTGCACTCCAAAAATTGATCATGAAGCTATCAAGGCGAAACGGGAGCGGGAGCTGGCAGCCGAG
GTGGAATTGGTGAAGAAGGAATACGAAGAACGGCTGCGTCGCAACAAGGAAAAAGAGGCCAACTTGGAAAAGAAC
CGAGGCAAAGAACATGACAAGGAACCGGACAAGGACGAAGACAAGGACAAGAAAGAGGAAAAGGAAAAGAATAAA
ATGACTGCAGACGAAAAAGAGCCCGGCCAAGAGATCAAGACAGAGGCCACGGCGCCTGATGAAGAAGAGTCCAGA
GTCTTTGAGCTCAAGAGCGCATTCTATCAGCAGCGACTTGGTAGAAAACGTCAGCTTGAAGCTGCCAAGAAAGAT
CGGGAAAGAGCTTCACAGTCCAACTACTTTCCCTCTGTTCCAAACAACTTGCCGGGTAAGTGA
Gene >OphauB2|1321
ATGGCGCCTCCTTTTCCAAACATTTACACACATCGCAAGGTGGCAGATGCTGCAGCCAAGTCATGCGACATCTGC
TATAAGCCCAGCACGTCGGTGCTCATTACGCCAGATCAAAAGGTGTCTTGCCATGAGCAACAGACAGGTCCAAGC
AAAAGGCTGACGCATTTCGAGGACTTCTTTTATGTCTGCACCATTCACCTCAAAGATACTCACTTTTGCACTCCA
AAAATTGATCATGAAGCTATCAAGGCGAAACGGGAGCGGGAGCTGGCAGCCGAGGTGGAATTGGTGAAGAAGGAA
TACGAAGAACGGCTGCGTCGCAACAAGGAAAAAGAGGCCAACTTGGAAAAGAACCGAGGCAAAGAACATGACAAG
GAACCGGACAAGGACGAAGACAAGGACAAGAAAGAGGAAAAGGAAAAGAATAAAATGACTGCAGACGAAAAAGAG
CCCGGCCAAGAGGTCTGTCATTGCCGCTTCTTTCAAATCGCGTTACTCAGACGTCACAGATCAAGACAGAGGCCA
CGGCGCCTGATGAAGAAGAGTCCAGAGTCTTTGAGCTCAAGAGGTTGGAGCTGTCAACCCAAGCTTGGCCCTGGC
AAGACGACGGGCTGACCAAGGACACAGCGCATTCTATCAGCAGCGACTTGGTAGAAAACGTCAGCTTGAAGCTGC
CAAGAAAGATCGGGAAAGAGCTTCACAGTCCAACTACTTTCCCTCTGTTCCAAACAACTTGCCGGGTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail