Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1320
Gene name
LocationContig_132:6453..7614
Strand+
Gene length (bp)1161
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 1.1E-10 19 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVH1 PE=1 SV=1 11 322 2.0E-40
sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 61 322 2.0E-34
sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 6 322 6.0E-32
sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 11 322 2.0E-30
sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 11 322 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02256|PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVH1 PE=1 SV=1 11 322 2.0E-40
sp|O13632|PVH1_SCHPO Tyrosine-protein phosphatase yvh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yvh1 PE=3 SV=1 61 322 2.0E-34
sp|Q9UNI6|DUS12_HUMAN Dual specificity protein phosphatase 12 OS=Homo sapiens GN=DUSP12 PE=1 SV=1 6 322 6.0E-32
sp|Q9D0T2|DUS12_MOUSE Dual specificity protein phosphatase 12 OS=Mus musculus GN=Dusp12 PE=2 SV=1 11 322 2.0E-30
sp|Q9JIM4|DUS12_RAT Dual specificity protein phosphatase 12 OS=Rattus norvegicus GN=Dusp12 PE=2 SV=1 11 322 2.0E-30
sp|Q570P7|DUSL1_ARATH Probable inactive dual specificity protein phosphatase-like At4g18593 OS=Arabidopsis thaliana GN=At4g18593 PE=2 SV=1 209 326 2.0E-15
sp|Q8R4V2|DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus GN=Dusp15 PE=2 SV=3 11 237 2.0E-12
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 11 172 3.0E-12
sp|Q9M8K7|DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana GN=DSPTP1B PE=1 SV=1 3 169 4.0E-12
sp|Q8K4T5|DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus GN=Dusp19 PE=2 SV=1 12 172 3.0E-11
sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 12 174 3.0E-11
sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 9 169 7.0E-11
sp|Q55E39|DUSP1_DICDI Probable dual specificity protein phosphatase DDB_G0269404 OS=Dictyostelium discoideum GN=DDB_G0269404 PE=3 SV=1 11 169 1.0E-10
sp|Q1LWL2|DS22A_DANRE Dual specificity protein phosphatase 22-A OS=Danio rerio GN=dusp22a PE=2 SV=2 10 190 3.0E-10
sp|Q566R7|DS22B_DANRE Dual specificity protein phosphatase 22-B OS=Danio rerio GN=dusp22b PE=2 SV=2 12 169 3.0E-10
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 10 170 6.0E-10
sp|Q39491|PTP3_CHLMO Dual specificity protein phosphatase OS=Chlamydomonas moewusii GN=VH-PTP13 PE=1 SV=1 37 169 8.0E-10
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 26 169 1.0E-09
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 26 169 1.0E-09
sp|Q9H1R2|DUS15_HUMAN Dual specificity protein phosphatase 15 OS=Homo sapiens GN=DUSP15 PE=1 SV=4 11 169 1.0E-09
sp|Q5XHB2|DUS22_XENTR Dual specificity protein phosphatase 22 OS=Xenopus tropicalis GN=dusp22 PE=2 SV=1 12 221 2.0E-09
sp|Q8TE77|SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens GN=SSH3 PE=1 SV=2 12 172 2.0E-09
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 11 174 3.0E-09
sp|Q9C5S1|MKP1_ARATH Protein-tyrosine-phosphatase MKP1 OS=Arabidopsis thaliana GN=MKP1 PE=1 SV=1 7 169 3.0E-09
sp|Q75QN6|DPHS1_ARATH Dual specificity protein phosphatase PHS1 OS=Arabidopsis thaliana GN=PHS1 PE=1 SV=1 9 169 3.0E-09
sp|Q99N11|DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus GN=Dusp22 PE=1 SV=1 11 221 4.0E-09
sp|Q9NRW4|DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens GN=DUSP22 PE=1 SV=1 11 221 1.0E-08
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 12 169 1.0E-08
sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 12 169 7.0E-08
sp|Q90W58|DUS1B_XENLA Dual specificity protein phosphatase 1-B OS=Xenopus laevis GN=dusp1-b PE=2 SV=1 12 174 1.0E-07
sp|Q91790|DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis GN=dusp1-a PE=1 SV=1 12 174 1.0E-07
sp|P28562|DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens GN=DUSP1 PE=1 SV=3 12 174 1.0E-06
sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 259 322 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0006793 phosphorus metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3731
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3537
Ophiocordyceps australis map64 (Brazil) OphauB2|1320 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00654
Ophiocordyceps camponoti-rufipedis Ophun1|5352
Ophiocordyceps kimflemingae Ophio5|3640
Ophiocordyceps subramaniannii Hirsu2|7283

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1320
MALSQIKGQEGLYVGGLWALRRCDQLEQRHITHVLSMVAFDASRLTNMRNEAWAEYGARFKHVTIDLDDVDDADL
LAELPRAVAFIHEGLASGAVFVHCAAGKSRSVSVVVGYLLWAKPGQFDPNTALAAGTQKRSPRETAGQAVDAALE
LVRLTRPMAEPNDGFMQQLALWWEMGCPDNVKSHGAYQRWAYNREVAEHVAIGQAPARLRFEDEEEGRNALPSAL
DATVARCKKCRKTLATAPFIQPHGPSATCSSSPCPHLFVEPLSWMRAELEKGQLKGRLACPNQRCGAAVGRYDWK
GIRCACGAWITPGLSLQRAKVDVSNSNASTRPDGLGPSQDDEATRMKMMGIRLPPGAGRGQHL*
Coding >OphauB2|1320
ATGGCTCTCAGCCAGATCAAAGGCCAGGAGGGTCTCTACGTGGGCGGCCTCTGGGCTCTCCGACGATGCGACCAA
CTCGAGCAAAGGCACATCACGCATGTGCTGTCTATGGTAGCCTTTGACGCGTCTCGCCTGACCAACATGAGGAAC
GAGGCGTGGGCCGAGTACGGAGCGCGGTTCAAGCATGTCACGATTGACCTGGACGATGTTGACGACGCCGACTTG
CTCGCGGAGCTGCCGCGGGCTGTTGCATTCATTCACGAGGGTTTGGCGAGTGGCGCAGTCTTTGTCCACTGTGCC
GCTGGAAAATCGCGGTCGGTTTCAGTAGTCGTGGGCTACCTGCTTTGGGCCAAGCCTGGCCAGTTTGATCCAAAC
ACAGCCTTGGCTGCAGGCACGCAAAAGCGGTCGCCGAGGGAAACGGCAGGCCAGGCGGTGGACGCGGCACTGGAG
CTAGTGCGGCTCACCCGCCCCATGGCCGAGCCCAACGACGGCTTCATGCAACAACTGGCTCTCTGGTGGGAAATG
GGCTGCCCCGACAATGTCAAGAGTCACGGCGCATACCAACGCTGGGCTTACAATCGCGAGGTTGCAGAGCACGTG
GCTATCGGACAGGCGCCGGCTCGCCTACGCTTTGAGGACGAAGAAGAGGGCCGCAATGCGTTGCCGTCAGCCTTG
GATGCCACCGTGGCTCGATGTAAAAAGTGTCGCAAGACCTTGGCAACTGCGCCCTTTATCCAGCCACATGGGCCA
AGCGCCACATGTTCAAGCAGCCCTTGTCCGCATTTGTTTGTGGAGCCGCTGAGCTGGATGCGGGCTGAACTGGAA
AAGGGCCAGTTGAAGGGCCGGCTAGCCTGCCCCAACCAGCGCTGCGGCGCCGCAGTGGGTAGGTATGACTGGAAA
GGCATCCGATGCGCATGCGGCGCTTGGATCACGCCTGGTCTGTCGTTGCAACGTGCAAAGGTGGATGTCAGCAAC
AGTAATGCCAGCACTCGGCCAGATGGACTCGGGCCAAGCCAAGACGATGAGGCCACCAGGATGAAAATGATGGGC
ATCAGACTGCCCCCTGGCGCTGGACGCGGGCAGCATCTATGA
Transcript >OphauB2|1320
ATGGCTCTCAGCCAGATCAAAGGCCAGGAGGGTCTCTACGTGGGCGGCCTCTGGGCTCTCCGACGATGCGACCAA
CTCGAGCAAAGGCACATCACGCATGTGCTGTCTATGGTAGCCTTTGACGCGTCTCGCCTGACCAACATGAGGAAC
GAGGCGTGGGCCGAGTACGGAGCGCGGTTCAAGCATGTCACGATTGACCTGGACGATGTTGACGACGCCGACTTG
CTCGCGGAGCTGCCGCGGGCTGTTGCATTCATTCACGAGGGTTTGGCGAGTGGCGCAGTCTTTGTCCACTGTGCC
GCTGGAAAATCGCGGTCGGTTTCAGTAGTCGTGGGCTACCTGCTTTGGGCCAAGCCTGGCCAGTTTGATCCAAAC
ACAGCCTTGGCTGCAGGCACGCAAAAGCGGTCGCCGAGGGAAACGGCAGGCCAGGCGGTGGACGCGGCACTGGAG
CTAGTGCGGCTCACCCGCCCCATGGCCGAGCCCAACGACGGCTTCATGCAACAACTGGCTCTCTGGTGGGAAATG
GGCTGCCCCGACAATGTCAAGAGTCACGGCGCATACCAACGCTGGGCTTACAATCGCGAGGTTGCAGAGCACGTG
GCTATCGGACAGGCGCCGGCTCGCCTACGCTTTGAGGACGAAGAAGAGGGCCGCAATGCGTTGCCGTCAGCCTTG
GATGCCACCGTGGCTCGATGTAAAAAGTGTCGCAAGACCTTGGCAACTGCGCCCTTTATCCAGCCACATGGGCCA
AGCGCCACATGTTCAAGCAGCCCTTGTCCGCATTTGTTTGTGGAGCCGCTGAGCTGGATGCGGGCTGAACTGGAA
AAGGGCCAGTTGAAGGGCCGGCTAGCCTGCCCCAACCAGCGCTGCGGCGCCGCAGTGGGTAGGTATGACTGGAAA
GGCATCCGATGCGCATGCGGCGCTTGGATCACGCCTGGTCTGTCGTTGCAACGTGCAAAGGTGGATGTCAGCAAC
AGTAATGCCAGCACTCGGCCAGATGGACTCGGGCCAAGCCAAGACGATGAGGCCACCAGGATGAAAATGATGGGC
ATCAGACTGCCCCCTGGCGCTGGACGCGGGCAGCATCTATGA
Gene >OphauB2|1320
ATGGCTCTCAGCCAGATCAAAGGCCAGGAGGGTCTCTACGTGGGCGGGTGAGTGGTATTGGCTGTCACACAGGCA
ATCAGCTGTGGCTTGGCTAAGGCAAAACATGTGCGCGGCAGCCTCTGGGCTCTCCGACGATGCGACCAACTCGAG
CAAAGGCACATCACGCATGTGCTGTCTATGGTAGCCTTTGACGCGTCTCGCCTGACCAACATGAGGAACGAGGCG
TGGGCCGAGTACGGAGCGCGGTTCAAGCATGTCACGATTGACCTGGACGATGTTGACGACGCCGACTTGCTCGCG
GAGCTGCCGCGGGCTGTTGCATTCATTCACGAGGGTTTGGCGAGTGGCGCAGTCTTTGTCCACTGTGCCGCTGGA
AAATCGCGGTCGGTTTCAGTAGTCGTGGGCTACCTGCTTTGGGCCAAGCCTGGCCAGTTTGATCCAAACACAGCC
TTGGCTGCAGGCACGCAAAAGCGGTCGCCGAGGGAAACGGCAGGCCAGGCGGTGGACGCGGCACTGGAGCTAGTG
CGGCTCACCCGCCCCATGGCCGAGCCCAACGACGGCTTCATGCAACAACTGGCTCTCTGGTGGGAAATGGGCTGC
CCCGACAATGTCAAGAGTCACGGCGCATACCAACGCTGGGCTTACAATCGCGAGGTTGCAGAGCACGTGGCTATC
GGACAGGCGCCGGCTCGCCTACGCTTTGAGGACGAAGAAGAGGGCCGCAATGCGTTGCCGTCAGCCTTGGATGCC
ACCGTGGCTCGATGTAAAAAGTGTCGCAAGACCTTGGCAACTGCGCCCTTTATCCAGCCACATGGGCCAAGCGCC
ACATGTTCAAGCAGCCCTTGTCCGCATTTGTTTGTGGAGCCGCTGAGCTGGATGCGGGCTGAACTGGAAAAGGGC
CAGTTGAAGGGCCGGCTAGCCTGCCCCAACCAGCGCTGCGGCGCCGCAGTGGGTAGGTATGACTGGAAAGGCATC
CGATGCGCATGCGGCGCTTGGATCACGCCTGGTCTGTCGTTGCAACGTGCAAAGGTGGATGTCAGCAACAGTAAT
GCCAGCACTCGGCCAGATGGACTCGGGCCAAGCCAAGACGATGAGGCCACCAGGATGAAAATGATGGGCATCAGA
CTGCCCCCTGGCGCTGGACGCGGGCAGCATCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail