Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1310
Gene name
LocationContig_131:32133..32601
Strand-
Gene length (bp)468
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04110 APG12 Ubiquitin-like autophagy protein Apg12 3.0E-26 31 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q51P78|ATG12_MAGO7 Ubiquitin-like protein ATG12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG12 PE=3 SV=1 1 118 5.0E-46
sp|Q7S083|ATG12_NEUCR Ubiquitin-like protein atg12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg12 PE=3 SV=1 1 118 2.0E-42
sp|A7EAE5|ATG12_SCLS1 Ubiquitin-like protein ATG12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg12 PE=3 SV=2 1 118 3.0E-40
sp|Q2GSG9|ATG12_CHAGB Ubiquitin-like protein ATG12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG12 PE=3 SV=2 1 118 7.0E-38
sp|Q2UMW6|ATG12_ASPOR Ubiquitin-like protein ATG12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg12 PE=3 SV=1 1 118 8.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q51P78|ATG12_MAGO7 Ubiquitin-like protein ATG12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG12 PE=3 SV=1 1 118 5.0E-46
sp|Q7S083|ATG12_NEUCR Ubiquitin-like protein atg12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg12 PE=3 SV=1 1 118 2.0E-42
sp|A7EAE5|ATG12_SCLS1 Ubiquitin-like protein ATG12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg12 PE=3 SV=2 1 118 3.0E-40
sp|Q2GSG9|ATG12_CHAGB Ubiquitin-like protein ATG12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG12 PE=3 SV=2 1 118 7.0E-38
sp|Q2UMW6|ATG12_ASPOR Ubiquitin-like protein ATG12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg12 PE=3 SV=1 1 118 8.0E-37
sp|A4D9P4|ATG12_ASPFU Ubiquitin-like protein ATG12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg12 PE=3 SV=1 1 118 1.0E-36
sp|A1DMW6|ATG12_NEOFI Ubiquitin-like protein ATG12 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg12 PE=3 SV=2 1 118 2.0E-36
sp|Q1E8C2|ATG12_COCIM Ubiquitin-like protein ATG12 OS=Coccidioides immitis (strain RS) GN=ATG12 PE=3 SV=1 1 118 4.0E-36
sp|A1CTJ1|ATG12_ASPCL Ubiquitin-like protein ATG12 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg12 PE=3 SV=2 1 118 9.0E-36
sp|A6RA46|ATG12_AJECN Ubiquitin-like protein ATG12 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG12 PE=3 SV=1 1 118 9.0E-36
sp|Q5BCH0|ATG12_EMENI Ubiquitin-like protein ATG12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg12 PE=3 SV=2 1 118 3.0E-35
sp|A7KAM3|ATG12_PENRW Ubiquitin-like protein ATG12 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg12 PE=3 SV=1 1 118 9.0E-35
sp|Q0UNW1|ATG12_PHANO Ubiquitin-like protein ATG12 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG12 PE=3 SV=1 1 118 2.0E-28
sp|P0CM28|ATG12_CRYNJ Ubiquitin-like protein ATG12 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG12 PE=3 SV=1 29 118 4.0E-22
sp|P0CM29|ATG12_CRYNB Ubiquitin-like protein ATG12 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG12 PE=3 SV=1 29 118 4.0E-22
sp|Q86CR6|ATG12_DICDI Ubiquitin-like protein atg12 OS=Dictyostelium discoideum GN=atg12 PE=3 SV=1 29 118 7.0E-20
sp|Q9US24|ATG12_SCHPO Ubiquitin-like protein ATG12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg12 PE=3 SV=1 31 118 4.0E-18
sp|Q6BU30|ATG12_DEBHA Ubiquitin-like protein ATG12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG12 PE=3 SV=1 1 118 2.0E-16
sp|A5E1F1|ATG12_LODEL Ubiquitin-like protein ATG12 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG12 PE=3 SV=1 10 118 6.0E-16
sp|Q69NP0|ATG12_ORYSJ Ubiquitin-like protein ATG12 OS=Oryza sativa subsp. japonica GN=ATG12 PE=3 SV=2 23 118 1.0E-15
sp|A2YAG8|ATG12_ORYSI Ubiquitin-like protein ATG12 OS=Oryza sativa subsp. indica GN=ATG12 PE=3 SV=2 23 118 1.0E-15
sp|Q6BZZ1|ATG12_YARLI Ubiquitin-like protein ATG12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG12 PE=3 SV=1 1 118 5.0E-15
sp|Q2TBJ5|ATG12_RAT Ubiquitin-like protein ATG12 OS=Rattus norvegicus GN=Atg12 PE=2 SV=1 11 118 2.0E-14
sp|O94817|ATG12_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens GN=ATG12 PE=1 SV=1 11 118 3.0E-14
sp|A7TJM4|ATG12_VANPO Ubiquitin-like protein ATG12 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG12 PE=3 SV=1 1 118 5.0E-14
sp|Q1SF86|ATG12_MEDTR Ubiquitin-like protein ATG12 OS=Medicago truncatula GN=ATG12 PE=3 SV=1 31 118 9.0E-14
sp|Q9LVK3|AT12B_ARATH Ubiquitin-like protein ATG12B OS=Arabidopsis thaliana GN=ATG12B PE=1 SV=1 31 118 9.0E-14
sp|Q5R7W1|ATG12_PONAB Ubiquitin-like protein ATG12 OS=Pongo abelii GN=ATG12 PE=2 SV=1 11 118 1.0E-13
sp|Q9CQY1|ATG12_MOUSE Ubiquitin-like protein ATG12 OS=Mus musculus GN=Atg12 PE=1 SV=1 11 118 1.0E-13
sp|Q8S924|AT12A_ARATH Ubiquitin-like protein ATG12A OS=Arabidopsis thaliana GN=ATG12A PE=1 SV=1 31 118 2.0E-13
sp|Q6FMM7|ATG12_CANGA Ubiquitin-like protein ATG12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG12 PE=3 SV=1 14 118 2.0E-13
sp|Q6CUD5|ATG12_KLULA Ubiquitin-like protein ATG12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG12 PE=3 SV=1 8 118 2.0E-13
sp|Q3T0W7|ATG12_BOVIN Ubiquitin-like protein ATG12 OS=Bos taurus GN=ATG12 PE=2 SV=1 11 118 8.0E-13
sp|Q5AKU4|ATG12_CANAL Ubiquitin-like protein ATG12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG12 PE=3 SV=1 7 118 2.0E-12
sp|P38316|ATG12_YEAST Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG12 PE=1 SV=1 31 118 2.0E-12
sp|A6ZLF7|ATG12_YEAS7 Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG12 PE=3 SV=1 31 118 2.0E-12
sp|Q9VTU1|APG12_DROME Autophagy protein 12-like OS=Drosophila melanogaster GN=Atg12 PE=3 SV=3 7 118 5.0E-12
sp|A3GI31|ATG12_PICST Ubiquitin-like protein ATG12 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG12 PE=3 SV=3 14 118 3.0E-11
sp|A5DK05|ATG12_PICGU Ubiquitin-like protein ATG12 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG12 PE=3 SV=2 3 118 4.0E-11
sp|A7KAJ7|ATG12_PICAN Ubiquitin-like protein ATG12 OS=Pichia angusta GN=ATG12 PE=3 SV=1 4 118 3.0E-09
sp|Q75EB4|ATG12_ASHGO Ubiquitin-like protein ATG12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG12 PE=3 SV=1 31 118 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0000045 autophagosome assembly Yes
GO:0005737 cytoplasm Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0070925 organelle assembly No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0007033 vacuole organization No
GO:0071840 cellular component organization or biogenesis No
GO:1905037 autophagosome organization No
GO:0044424 intracellular part No
GO:0044464 cell part No
GO:0006996 organelle organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1310
MMASVVLSSLPQASTAALATTWAAAGYGESKVVVRFKAVGSAPALAQDVCKISAGRRFEEVVRYVRRKLRCNESE
SVFLYVNSAFAPALDEVVGNLHRCFKNSHNQLIVAYSMTPAFG*
Coding >OphauB2|1310
ATGATGGCATCCGTCGTCTTGTCCTCACTGCCACAAGCCTCAACAGCAGCACTGGCCACGACTTGGGCAGCCGCG
GGCTACGGCGAGAGCAAGGTAGTGGTGCGCTTCAAGGCGGTTGGGTCGGCGCCCGCTCTGGCGCAGGACGTGTGC
AAGATTAGTGCTGGGCGCCGGTTTGAAGAGGTGGTGCGCTATGTGAGGCGCAAGTTGAGGTGCAATGAGAGCGAG
TCGGTGTTTTTGTATGTCAACAGTGCCTTTGCGCCAGCCTTGGACGAAGTGGTGGGCAATTTGCATCGGTGCTTC
AAAAACTCGCATAACCAGCTCATCGTTGCCTACTCAATGACGCCCGCCTTTGGCTAG
Transcript >OphauB2|1310
ATGATGGCATCCGTCGTCTTGTCCTCACTGCCACAAGCCTCAACAGCAGCACTGGCCACGACTTGGGCAGCCGCG
GGCTACGGCGAGAGCAAGGTAGTGGTGCGCTTCAAGGCGGTTGGGTCGGCGCCCGCTCTGGCGCAGGACGTGTGC
AAGATTAGTGCTGGGCGCCGGTTTGAAGAGGTGGTGCGCTATGTGAGGCGCAAGTTGAGGTGCAATGAGAGCGAG
TCGGTGTTTTTGTATGTCAACAGTGCCTTTGCGCCAGCCTTGGACGAAGTGGTGGGCAATTTGCATCGGTGCTTC
AAAAACTCGCATAACCAGCTCATCGTTGCCTACTCAATGACGCCCGCCTTTGGCTAG
Gene >OphauB2|1310
ATGATGGCATCCGTCGTCTTGTCCTCACTGCCACAAGCCTCAACAGCAGCACTGGCCACGACTTGGGCAGCCGCG
GGCTACGGCGAGAGCAAGGTAGTGGTGCGCTTCAAGGCGGTTGGGTCGGCGCCCGCTCTGGCGCAGGACGTGTGC
AAGATTAGTGCTGGGCGCCGGTTTGAAGAGGTGGTGCGCTATGTGAGGCGCAAGTTGAGGTGCAATGAGAGCGAG
TCGGTGTTTTTGTATGTCAACAGTGCCTTTGCGCCAGCCTTGGACGAAGTGGTGGGCAATTTGCATCGGGTGAGT
TTTGTTACATCCTTCTTCATTCTTGTCCAAAGTCCATTTTCAATTTGCATCAGACAGACACCTAGTCGTCTTGGC
AAGAAAAGGACGGCTAACCGCCTGCAACAGTGCTTCAAAAACTCGCATAACCAGCTCATCGTTGCCTACTCAATG
ACGCCCGCCTTTGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail