Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1309
Gene name
LocationContig_131:30775..31876
Strand+
Gene length (bp)1101
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase 8.7E-105 65 324
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 7.7E-08 71 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 47 344 5.0E-163
sp|Q311U7|PANB_DESAG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=panB PE=3 SV=1 81 345 2.0E-86
sp|Q9M315|PANB2_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=KPHMT2 PE=1 SV=1 33 344 1.0E-84
sp|Q833S5|PANB_ENTFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=panB PE=3 SV=1 65 333 2.0E-84
sp|O82357|PANB1_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=KPHMT1 PE=1 SV=1 56 339 3.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 47 344 5.0E-163
sp|Q311U7|PANB_DESAG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=panB PE=3 SV=1 81 345 2.0E-86
sp|Q9M315|PANB2_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=KPHMT2 PE=1 SV=1 33 344 1.0E-84
sp|Q833S5|PANB_ENTFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=panB PE=3 SV=1 65 333 2.0E-84
sp|O82357|PANB1_ARATH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=KPHMT1 PE=1 SV=1 56 339 3.0E-84
sp|B2V1L8|PANB_CLOBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=panB PE=3 SV=1 65 336 1.0E-83
sp|Q3A9L0|PANB_CARHZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=panB PE=3 SV=1 65 332 1.0E-83
sp|A0PXQ3|PANB_CLONN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=panB PE=3 SV=1 65 334 4.0E-83
sp|Q2RM79|PANB_MOOTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=panB PE=3 SV=1 63 329 5.0E-83
sp|Q9AWZ7|PANB2_ORYSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=KPHMT2 PE=3 SV=1 64 344 3.0E-82
sp|B9LII0|PANB_CHLSY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=panB PE=3 SV=1 65 338 2.0E-81
sp|A9WFR7|PANB_CHLAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=panB PE=3 SV=1 65 338 2.0E-81
sp|B0K365|PANB_THEPX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=panB PE=3 SV=1 63 335 4.0E-81
sp|B0KC90|PANB_THEP3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=panB PE=3 SV=1 63 335 4.0E-81
sp|A1VBJ4|PANB_DESVV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=panB PE=3 SV=1 50 344 1.0E-80
sp|Q729A6|PANB_DESVH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=panB PE=3 SV=1 50 344 1.0E-80
sp|Q0SHJ0|PANB_RHOJR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodococcus jostii (strain RHA1) GN=panB PE=3 SV=1 56 329 3.0E-80
sp|Q2LTJ5|PANB_SYNAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=panB PE=3 SV=2 64 329 3.0E-80
sp|C0QFH9|PANB_DESAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=panB PE=3 SV=1 65 329 6.0E-80
sp|B0TC10|PANB_HELMI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=panB PE=3 SV=1 64 333 5.0E-79
sp|Q9AWZ8|PANB1_ORYSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=KPHMT1 PE=2 SV=1 64 344 5.0E-79
sp|B7HHU3|PANB_BACC4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain B4264) GN=panB PE=3 SV=1 73 335 9.0E-78
sp|Q18C32|PANB_PEPD6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Peptoclostridium difficile (strain 630) GN=panB PE=3 SV=1 65 336 9.0E-78
sp|Q81FN7|PANB_BACCR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=panB PE=3 SV=1 73 335 1.0E-77
sp|Q3Z8B4|PANB_DEHM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=panB PE=3 SV=2 65 346 1.0E-77
sp|B7HL53|PANB_BACC7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain AH187) GN=panB PE=3 SV=1 73 339 2.0E-77
sp|A7GN76|PANB_BACCN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=panB PE=3 SV=1 74 345 2.0E-77
sp|Q6HL16|PANB_BACHK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|Q63DJ3|PANB_BACCZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|C1EN36|PANB_BACC3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain 03BB102) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|B7JHQ6|PANB_BACC0 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain AH820) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|Q81ST3|PANB_BACAN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis GN=panB PE=3 SV=1 73 339 3.0E-77
sp|A0RBZ2|PANB_BACAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|C3L8Q0|PANB_BACAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|C3P5Q9|PANB_BACAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus anthracis (strain A0248) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|B7IPB7|PANB_BACC2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain G9842) GN=panB PE=3 SV=1 73 339 3.0E-77
sp|A6LWN6|PANB_CLOB8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=panB PE=3 SV=1 65 336 4.0E-77
sp|Q73AV4|PANB_BACC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=panB PE=3 SV=1 73 339 5.0E-77
sp|Q3ZXG0|PANB_DEHMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=panB PE=3 SV=1 65 343 7.0E-77
sp|B1GZJ8|PANB_UNCTG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=panB PE=3 SV=1 64 329 8.0E-77
sp|Q0B0P6|PANB_SYNWW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=panB PE=3 SV=1 65 333 1.0E-76
sp|A5FR68|PANB_DEHMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=panB PE=3 SV=1 65 343 1.0E-76
sp|A0LLW3|PANB_SYNFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=panB PE=3 SV=1 81 340 1.0E-76
sp|O58665|PANB_PYRHO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=panB PE=3 SV=1 64 335 2.0E-76
sp|A9VME9|PANB_BACWK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=panB PE=3 SV=1 73 339 4.0E-76
sp|Q9PIK1|PANB_CAMJE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=panB PE=3 SV=1 76 336 6.0E-76
sp|A8FK87|PANB_CAMJ8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=panB PE=3 SV=1 76 336 6.0E-76
sp|A8A9H3|PANB_IGNH4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=panB PE=3 SV=1 64 329 8.0E-76
sp|Q29W37|PANB_CAMJJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=panB PE=3 SV=1 76 336 8.0E-76
sp|A5N5W0|PANB_CLOK5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=panB PE=3 SV=1 65 334 1.0E-75
sp|A6TMH9|PANB_ALKMQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=panB PE=3 SV=1 64 336 3.0E-75
sp|A7GAI6|PANB_CLOBL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=panB PE=3 SV=1 67 333 5.0E-75
sp|B1IEL6|PANB_CLOBK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=panB PE=3 SV=1 67 333 5.0E-75
sp|C1FS97|PANB_CLOBJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=panB PE=3 SV=1 67 333 5.0E-75
sp|Q9V0E1|PANB_PYRAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=panB PE=3 SV=1 61 335 5.0E-75
sp|Q5HWH3|PANB_CAMJR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni (strain RM1221) GN=panB PE=3 SV=1 77 336 6.0E-75
sp|A7FR60|PANB_CLOB1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=panB PE=3 SV=1 67 333 6.0E-75
sp|A7HGZ2|PANB_ANADF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=panB PE=3 SV=1 57 329 8.0E-75
sp|B8J7G7|PANB_ANAD2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=panB PE=3 SV=1 55 329 1.0E-74
sp|Q8U1R2|PANB_PYRFU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=panB PE=3 SV=1 72 335 1.0E-74
sp|Q5KXX2|PANB_GEOKA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=panB PE=3 SV=1 74 345 2.0E-74
sp|B1KUY7|PANB_CLOBM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=panB PE=3 SV=1 67 333 2.0E-74
sp|B4UDZ3|PANB_ANASK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain K) GN=panB PE=3 SV=1 55 329 2.0E-74
sp|A0M360|PANB_GRAFK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gramella forsetii (strain KT0803) GN=panB PE=3 SV=2 64 329 2.0E-74
sp|C3L035|PANB_CLOB6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=panB PE=3 SV=1 67 333 3.0E-74
sp|Q5YZ95|PANB_NOCFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=panB PE=3 SV=1 59 329 3.0E-74
sp|B8G644|PANB_CHLAD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=panB PE=3 SV=1 65 344 4.0E-74
sp|Q1B6P5|PANB_MYCSS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain MCS) GN=panB PE=3 SV=1 58 329 7.0E-74
sp|A1UID0|PANB_MYCSK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain KMS) GN=panB PE=3 SV=1 58 329 7.0E-74
sp|A3Q1U4|PANB_MYCSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium sp. (strain JLS) GN=panB PE=3 SV=1 58 329 7.0E-74
sp|A7H574|PANB_CAMJD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=panB PE=3 SV=1 77 329 7.0E-74
sp|A4IQ61|PANB_GEOTN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=panB PE=3 SV=1 81 339 1.0E-73
sp|B9M2A3|PANB_GEODF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=panB PE=3 SV=1 63 329 4.0E-73
sp|B8FFR9|PANB_DESAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=panB PE=3 SV=1 64 329 6.0E-73
sp|C5D3B3|PANB_GEOSW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacillus sp. (strain WCH70) GN=panB PE=3 SV=1 73 339 1.0E-72
sp|Q8FUA5|PANB_COREF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=panB PE=3 SV=2 64 329 1.0E-72
sp|B8HWP9|PANB_CYAP4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=panB PE=3 SV=1 66 323 1.0E-72
sp|A3DDV7|PANB_CLOTH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=panB PE=3 SV=1 65 333 1.0E-72
sp|Q5JCY6|PANB_THEKO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=panB PE=3 SV=1 61 335 1.0E-72
sp|Q97F39|PANB_CLOAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=panB PE=3 SV=1 65 334 2.0E-72
sp|A2SDV6|PANB1_METPP 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Methylibium petroleiphilum (strain PM1) GN=panB1 PE=3 SV=1 57 344 3.0E-72
sp|Q0RFD5|PANB_FRAAA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Frankia alni (strain ACN14a) GN=panB PE=3 SV=2 56 329 5.0E-72
sp|Q74CG8|PANB_GEOSL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=panB PE=3 SV=1 67 329 7.0E-72
sp|Q39V51|PANB_GEOMG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=panB PE=3 SV=1 63 329 8.0E-72
sp|B2HHM7|PANB_MYCMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=panB PE=3 SV=1 50 329 1.0E-71
sp|A1AUV8|PANB_PELPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=panB PE=3 SV=1 63 329 1.0E-71
sp|Q2IFU2|PANB_ANADE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=panB PE=3 SV=1 50 329 1.0E-71
sp|A0PNG6|PANB_MYCUA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=panB PE=3 SV=1 57 329 1.0E-71
sp|Q5WGA3|PANB_BACSK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=panB PE=3 SV=1 67 338 1.0E-71
sp|Q6G5H3|PANB_BARHE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=panB PE=3 SV=1 64 333 2.0E-71
sp|Q47R98|PANB_THEFY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=panB PE=3 SV=1 50 329 2.0E-71
sp|Q9KC87|PANB_BACHD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=panB PE=3 SV=1 67 333 5.0E-71
sp|Q3A3I6|PANB_PELCD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=panB PE=3 SV=1 63 329 6.0E-71
sp|Q1IHA5|PANB_KORVE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=panB PE=3 SV=1 63 331 8.0E-71
sp|Q7NMK3|PANB_GLOVI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=panB PE=3 SV=2 66 320 3.0E-70
sp|Q9L7B2|PANB_MYCVP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=panB PE=3 SV=1 62 329 3.0E-70
sp|Q1GLQ6|PANB_RUEST 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruegeria sp. (strain TM1040) GN=panB PE=3 SV=1 81 329 3.0E-70
sp|A1RU92|PANB_PYRIL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=panB PE=3 SV=1 84 327 3.0E-70
sp|B3E5K9|PANB_GEOLS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=panB PE=3 SV=1 63 329 6.0E-70
sp|Q65I56|PANB_BACLD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=panB PE=3 SV=1 74 333 8.0E-70
sp|Q6AJ44|PANB_DESPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=panB PE=3 SV=2 67 332 9.0E-70
sp|A8F498|PANB_PSELT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=panB PE=3 SV=1 66 333 1.0E-69
sp|Q3J5N1|PANB_RHOS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=panB PE=3 SV=1 78 329 1.0E-69
sp|A3PGQ2|PANB_RHOS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=panB PE=3 SV=1 78 329 1.0E-69
sp|B8G1S3|PANB_DESHD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=panB PE=3 SV=1 74 336 1.0E-69
sp|A2BMY4|PANB_HYPBU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=panB PE=3 SV=1 63 346 1.0E-69
sp|A4WMD4|PANB_PYRAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=panB PE=3 SV=1 84 327 1.0E-69
sp|B1LAU5|PANB_THESQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga sp. (strain RQ2) GN=panB PE=3 SV=1 81 329 2.0E-69
sp|Q9X251|PANB_THEMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=panB PE=3 SV=1 81 329 2.0E-69
sp|A9H9N2|PANB_GLUDA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=panB PE=3 SV=1 65 342 2.0E-69
sp|B1YBD4|PANB_PYRNV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=panB PE=3 SV=1 76 327 2.0E-69
sp|B0BYP7|PANB_ACAM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=panB PE=3 SV=1 66 323 3.0E-69
sp|B9K819|PANB_THENN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=panB PE=3 SV=1 81 329 3.0E-69
sp|Q8XW45|PANB_RALSO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=panB PE=3 SV=1 63 329 3.0E-69
sp|A5FAQ5|PANB_FLAJ1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=panB PE=3 SV=1 64 329 4.0E-69
sp|Q8ZT69|PANB_PYRAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=panB PE=3 SV=1 84 327 4.0E-69
sp|Q4JWH1|PANB_CORJK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium jeikeium (strain K411) GN=panB PE=3 SV=2 62 329 4.0E-69
sp|C3MU48|PANB_SULIM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=panB PE=3 SV=1 64 327 6.0E-69
sp|C4KKA3|PANB_SULIK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=panB PE=3 SV=1 64 327 6.0E-69
sp|C3N136|PANB_SULIA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=panB PE=3 SV=1 64 327 6.0E-69
sp|A8MAX6|PANB_CALMQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=panB PE=3 SV=1 63 327 7.0E-69
sp|Q250S5|PANB_DESHY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=panB PE=3 SV=1 74 336 8.0E-69
sp|C3MK79|PANB_SULIL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=panB PE=3 SV=1 64 327 8.0E-69
sp|Q9RKS2|PANB_STRCO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=panB PE=3 SV=1 63 328 9.0E-69
sp|C3N926|PANB_SULIY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=panB PE=3 SV=1 64 327 1.0E-68
sp|Q1DAN9|PANB_MYXXD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=panB PE=3 SV=1 63 329 1.0E-68
sp|A1SIB6|PANB_NOCSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=panB PE=3 SV=1 53 329 2.0E-68
sp|Q11Q55|PANB_CYTH3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=panB PE=3 SV=1 64 329 2.0E-68
sp|A4WVH0|PANB_RHOS5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=panB PE=3 SV=1 78 330 2.0E-68
sp|C3NMB9|PANB_SULIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=panB PE=3 SV=1 64 327 2.0E-68
sp|A0L3M6|PANB_MAGMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=panB PE=3 SV=1 63 329 2.0E-68
sp|A4FA49|PANB_SACEN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=panB PE=3 SV=1 53 329 3.0E-68
sp|P9WIL7|PANB_MYCTU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=panB PE=1 SV=1 45 329 5.0E-68
sp|P9WIL6|PANB_MYCTO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=panB PE=3 SV=1 45 329 5.0E-68
sp|A1KKR8|PANB_MYCBP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=panB PE=3 SV=1 45 329 5.0E-68
sp|P0C2T4|PANB_MYCBO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=panB PE=3 SV=1 45 329 5.0E-68
sp|Q7NXJ1|PANB_CHRVO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=panB PE=3 SV=1 65 329 5.0E-68
sp|A5G3A0|PANB_GEOUR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=panB PE=3 SV=1 63 329 6.0E-68
sp|Q215V6|PANB_RHOPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=panB PE=3 SV=1 78 329 6.0E-68
sp|A4QAA6|PANB_CORGB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium glutamicum (strain R) GN=panB PE=3 SV=1 64 329 6.0E-68
sp|B1HU19|PANB_LYSSC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=panB PE=3 SV=1 65 333 7.0E-68
sp|Q63R49|PANB_BURPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|A3ND64|PANB_BURP6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 668) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|Q3JP15|PANB_BURP1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=panB PE=1 SV=2 63 329 7.0E-68
sp|A3NYX3|PANB_BURP0 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|A1V0V0|PANB_BURMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain SAVP1) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|Q62HD8|PANB_BURMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=panB PE=3 SV=2 63 329 7.0E-68
sp|A2S561|PANB_BURM9 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|A3MN95|PANB_BURM7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=panB PE=3 SV=1 63 329 7.0E-68
sp|B2UBN8|PANB_RALPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ralstonia pickettii (strain 12J) GN=panB PE=3 SV=1 63 329 8.0E-68
sp|Q2SYZ1|PANB_BURTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=panB PE=1 SV=2 63 329 8.0E-68
sp|Q9X712|PANB_CORGL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=panB PE=1 SV=2 64 329 8.0E-68
sp|B1XQ35|PANB_SYNP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=panB PE=3 SV=1 65 323 9.0E-68
sp|Q82AW2|PANB_STRAW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=panB PE=3 SV=1 64 328 2.0E-67
sp|Q73YI6|PANB_MYCPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=panB PE=3 SV=1 59 329 2.0E-67
sp|B5E846|PANB_GEOBB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=panB PE=3 SV=1 63 329 2.0E-67
sp|Q07LA4|PANB_RHOP5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=panB PE=3 SV=1 78 329 4.0E-67
sp|Q1BYX0|PANB_BURCA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=panB PE=3 SV=1 63 329 4.0E-67
sp|A0K4T1|PANB1_BURCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia cenocepacia (strain HI2424) GN=panB1 PE=3 SV=1 63 329 4.0E-67
sp|Q0BI15|PANB1_BURCM 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=panB1 PE=3 SV=1 63 329 4.0E-67
sp|B2JGD9|PANB_BURP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=panB PE=3 SV=1 61 329 5.0E-67
sp|A9A2T9|PANB_NITMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosopumilus maritimus (strain SCM1) GN=panB PE=3 SV=1 81 343 5.0E-67
sp|A0RXQ5|PANB_CENSY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cenarchaeum symbiosum (strain A) GN=panB PE=3 SV=1 79 335 6.0E-67
sp|Q1LJ86|PANB_CUPMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=panB PE=3 SV=1 63 329 9.0E-67
sp|A4XMZ4|PANB_CALS8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=panB PE=3 SV=1 65 329 1.0E-66
sp|Q2JNI1|PANB_SYNJB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=panB PE=3 SV=1 66 325 1.0E-66
sp|Q6N583|PANB_RHOPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=panB PE=3 SV=1 78 329 1.0E-66
sp|Q135K5|PANB_RHOPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=panB PE=3 SV=1 78 329 2.0E-66
sp|Q46XJ2|PANB_CUPPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=panB PE=3 SV=1 63 329 2.0E-66
sp|Q2IXB0|PANB_RHOP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=panB PE=3 SV=1 78 329 2.0E-66
sp|A8FEH7|PANB_BACP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=panB PE=3 SV=1 73 333 2.0E-66
sp|A7IF97|PANB_XANP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=panB PE=3 SV=1 78 329 2.0E-66
sp|B7IDK8|PANB_THEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosipho africanus (strain TCF52B) GN=panB PE=3 SV=1 79 329 2.0E-66
sp|A9IHJ7|PANB_BORPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=panB PE=3 SV=1 75 332 3.0E-66
sp|Q0ADS2|PANB_NITEC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosomonas eutropha (strain C91) GN=panB PE=3 SV=1 64 329 4.0E-66
sp|A7Z5Z4|PANB_BACMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=panB PE=3 SV=1 74 333 6.0E-66
sp|Q1QMP7|PANB_NITHX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=panB PE=3 SV=1 77 329 6.0E-66
sp|Q82Y18|PANB_NITEU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=panB PE=3 SV=1 64 329 7.0E-66
sp|A6LMK5|PANB_THEM4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=panB PE=3 SV=1 72 329 7.0E-66
sp|B6YS36|PANB_AZOPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=panB PE=3 SV=1 64 329 9.0E-66
sp|Q0BSQ3|PANB_GRABC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=panB PE=3 SV=1 78 332 1.0E-65
sp|B9DKF4|PANB_STACT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=panB PE=3 SV=1 68 329 2.0E-65
sp|Q1GR07|PANB_SPHAL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=panB PE=3 SV=1 57 329 2.0E-65
sp|C5CFR2|PANB_KOSOT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=panB PE=3 SV=1 74 329 2.0E-65
sp|B9ML78|PANB_CALBD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=panB PE=3 SV=1 65 329 2.0E-65
sp|Q89MZ4|PANB3_BRADU 3-methyl-2-oxobutanoate hydroxymethyltransferase 3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panB3 PE=3 SV=1 74 334 2.0E-65
sp|B3EDF1|PANB_CHLL2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=panB PE=3 SV=1 66 329 3.0E-65
sp|Q2JRY1|PANB_SYNJA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=panB PE=3 SV=1 66 323 4.0E-65
sp|Q2S1H6|PANB_SALRD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=panB PE=3 SV=1 65 329 5.0E-65
sp|A1BH02|PANB_CHLPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=panB PE=3 SV=1 66 329 5.0E-65
sp|A6L3Y2|PANB_BACV8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=panB PE=3 SV=1 64 329 6.0E-65
sp|B1ZHG6|PANB_METPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=panB PE=3 SV=1 76 330 6.0E-65
sp|Q4LA35|PANB_STAHJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=panB PE=3 SV=1 67 329 7.0E-65
sp|Q11F82|PANB_CHESB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chelativorans sp. (strain BNC1) GN=panB PE=3 SV=1 76 329 9.0E-65
sp|A4JBS4|PANB_BURVG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=panB PE=3 SV=1 63 329 1.0E-64
sp|Q3SR08|PANB_NITWN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=panB PE=3 SV=1 77 329 1.0E-64
sp|A9W3L5|PANB_METEP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium extorquens (strain PA1) GN=panB PE=3 SV=1 76 330 1.0E-64
sp|B7KWY8|PANB_METC4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=panB PE=3 SV=1 76 330 1.0E-64
sp|B6JGY0|PANB_OLICO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=panB PE=3 SV=1 78 331 1.0E-64
sp|C4L6Q0|PANB_EXISA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=panB PE=3 SV=1 67 334 1.0E-64
sp|B3Q9V6|PANB_RHOPT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=panB PE=3 SV=1 78 329 1.0E-64
sp|Q5LWP5|PANB_RUEPO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=panB PE=3 SV=1 84 329 2.0E-64
sp|Q4JA70|PANB_SULAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=panB PE=3 SV=1 74 327 2.0E-64
sp|Q8DM44|PANB_THEEB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=panB PE=3 SV=2 63 323 2.0E-64
sp|Q6AFH4|PANB_LEIXX 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=panB PE=3 SV=1 59 329 2.0E-64
sp|Q2VZ01|PANB_MAGSA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=panB PE=3 SV=1 70 333 3.0E-64
sp|Q97W44|PANB_SULSO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=panB PE=3 SV=1 64 327 4.0E-64
sp|Q5N1A6|PANB_SYNP6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=panB PE=3 SV=1 59 322 4.0E-64
sp|Q31KK8|PANB_SYNE7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=panB PE=3 SV=1 59 322 4.0E-64
sp|Q3M672|PANB_ANAVT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=panB PE=3 SV=1 66 323 4.0E-64
sp|Q5SL86|PANB_THET8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=panB PE=3 SV=1 75 329 4.0E-64
sp|P65655|PANB_BRUSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|P65654|PANB_BRUME 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|C0RH46|PANB_BRUMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|A9M8B3|PANB_BRUC2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|Q57F29|PANB_BRUAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|Q2YPI1|PANB_BRUA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus (strain 2308) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|B2S9H9|PANB_BRUA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella abortus (strain S19) GN=panB PE=3 SV=1 57 329 4.0E-64
sp|Q9YE97|PANB_AERPE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=panB PE=3 SV=1 62 328 5.0E-64
sp|Q72LM0|PANB_THET2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=panB PE=3 SV=2 75 329 5.0E-64
sp|A9AGB5|PANB_BURM1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=panB PE=3 SV=1 63 329 6.0E-64
sp|A3DPB2|PANB_STAMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=panB PE=3 SV=1 64 329 7.0E-64
sp|A6UB62|PANB_SINMW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=panB PE=3 SV=1 61 331 9.0E-64
sp|Q39JC5|PANB2_BURL3 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=panB2 PE=3 SV=1 63 329 1.0E-63
sp|B0CJW1|PANB_BRUSI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=panB PE=3 SV=1 57 329 2.0E-63
sp|B9JXS3|PANB_AGRVS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=panB PE=3 SV=1 55 329 2.0E-63
sp|B9JH27|PANB_AGRRK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=panB PE=3 SV=1 81 329 2.0E-63
sp|A6LA68|PANB_PARD8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=panB PE=3 SV=1 55 329 2.0E-63
sp|Q9CBT0|PANB_MYCLE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium leprae (strain TN) GN=panB PE=3 SV=1 63 329 2.0E-63
sp|A0QEV5|PANB_MYCA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Mycobacterium avium (strain 104) GN=panB PE=3 SV=1 63 329 2.0E-63
sp|A1R5H8|PANB_ARTAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arthrobacter aurescens (strain TC1) GN=panB PE=3 SV=1 62 329 2.0E-63
sp|Q931E6|PANB_STAAM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=panB PE=3 SV=1 67 329 2.0E-63
sp|A7X6X7|PANB_STAA1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=panB PE=3 SV=1 67 329 2.0E-63
sp|P65657|PANB_STAAW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MW2) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|A8Z3J9|PANB_STAAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|Q6G677|PANB_STAAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|P65656|PANB_STAAN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain N315) GN=panB PE=1 SV=1 67 329 3.0E-63
sp|A5IW24|PANB_STAA9 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain JH9) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|Q2FV21|PANB_STAA8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=panB PE=3 SV=2 67 329 3.0E-63
sp|Q2FDR0|PANB_STAA3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300) GN=panB PE=3 SV=2 67 329 3.0E-63
sp|A6U4X9|PANB_STAA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain JH1) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|C3MEL6|PANB_RHISN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium sp. (strain NGR234) GN=panB PE=3 SV=1 61 331 3.0E-63
sp|Q9A7R9|PANB_CAUCR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=panB PE=3 SV=2 81 329 3.0E-63
sp|B8GVL8|PANB_CAUCN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=panB PE=3 SV=1 81 329 3.0E-63
sp|Q5HCV3|PANB_STAAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain COL) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|Q2G6P1|PANB_NOVAD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=panB PE=3 SV=1 57 329 3.0E-63
sp|Q6GDK4|PANB_STAAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=panB PE=3 SV=1 67 329 3.0E-63
sp|A3MWA6|PANB_PYRCJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=panB PE=3 SV=1 63 330 3.0E-63
sp|Q7MWM0|PANB_PORGI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=panB PE=3 SV=1 64 329 3.0E-63
sp|B2RIF8|PANB_PORG3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=panB PE=3 SV=1 64 329 3.0E-63
sp|Q2YWF9|PANB_STAAB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=panB PE=3 SV=1 67 329 4.0E-63
sp|P52996|PANB_BACSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacillus subtilis (strain 168) GN=panB PE=3 SV=1 81 333 4.0E-63
sp|B3QMS8|PANB_CHLP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=panB PE=3 SV=1 54 329 4.0E-63
sp|Q92NN1|PANB_RHIME 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium meliloti (strain 1021) GN=panB PE=3 SV=1 61 331 5.0E-63
sp|B3EQ18|PANB_CHLPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=panB PE=3 SV=1 66 329 5.0E-63
sp|Q2YAN9|PANB_NITMU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=panB PE=3 SV=1 65 329 5.0E-63
sp|A9IRP2|PANB_BART1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=panB PE=3 SV=1 64 332 8.0E-63
sp|Q64UB9|PANB_BACFR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=panB PE=3 SV=1 64 329 1.0E-62
sp|Q5LD96|PANB_BACFN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=panB PE=3 SV=1 64 329 1.0E-62
sp|Q10WG3|PANB_TRIEI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=panB PE=3 SV=1 66 323 1.0E-62
sp|Q8KCS2|PANB_CHLTE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=panB PE=3 SV=1 55 329 1.0E-62
sp|Q8YWS8|PANB_NOSS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=panB PE=3 SV=1 66 323 1.0E-62
sp|Q974Y0|PANB_SULTO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=panB PE=3 SV=1 64 327 2.0E-62
sp|B1LTL1|PANB_METRJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=panB PE=3 SV=1 76 329 2.0E-62
sp|A6QK86|PANB_STAAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus aureus (strain Newman) GN=panB PE=3 SV=1 67 329 2.0E-62
sp|A1KAA5|PANB_AZOSB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Azoarcus sp. (strain BH72) GN=panB PE=3 SV=1 64 329 2.0E-62
sp|B2SXC3|PANB_BURPP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=panB PE=3 SV=1 63 329 2.0E-62
sp|Q92AA6|PANB_LISIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=panB PE=3 SV=1 73 336 3.0E-62
sp|Q3B394|PANB_CHLL7 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=panB PE=3 SV=1 66 329 3.0E-62
sp|Q3SH83|PANB_THIDA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=panB PE=3 SV=1 66 329 3.0E-62
sp|Q9RR81|PANB_DEIRA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=panB PE=3 SV=2 55 333 4.0E-62
sp|A3QHQ1|PANB_SHELP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=panB PE=3 SV=1 65 329 4.0E-62
sp|Q21F95|PANB_SACD2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=panB PE=3 SV=1 60 329 4.0E-62
sp|Q8Y601|PANB_LISMO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=panB PE=3 SV=1 73 336 4.0E-62
sp|A4SE31|PANB_CHLPM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=panB PE=3 SV=1 66 329 4.0E-62
sp|B4RAD7|PANB_PHEZH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=panB PE=3 SV=1 78 329 5.0E-62
sp|A0AK07|PANB_LISW6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=panB PE=3 SV=1 71 336 5.0E-62
sp|Q9I3C3|PANB1_PSEAE 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panB1 PE=3 SV=1 62 333 5.0E-62
sp|Q02K83|PANB1_PSEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=panB1 PE=3 SV=1 62 333 5.0E-62
sp|Q145E8|PANB_BURXL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Burkholderia xenovorans (strain LB400) GN=panB PE=3 SV=1 63 329 7.0E-62
sp|B7JVF9|PANB_CYAP8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=panB PE=3 SV=1 66 323 1.0E-61
sp|Q3JCP9|PANB_NITOC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=panB PE=3 SV=1 65 329 1.0E-61
sp|A0JVB5|PANB_ARTS2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arthrobacter sp. (strain FB24) GN=panB PE=3 SV=1 59 329 1.0E-61
sp|A8G084|PANB_SHESH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=panB PE=3 SV=1 65 329 1.0E-61
sp|Q5NL16|PANB2_ZYMMO 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=panB2 PE=3 SV=1 55 329 1.0E-61
sp|Q71YB3|PANB_LISMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=panB PE=3 SV=1 73 336 1.0E-61
sp|C1KWK2|PANB_LISMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=panB PE=3 SV=1 73 336 1.0E-61
sp|B4SAH9|PANB_PELPB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=panB PE=3 SV=1 66 329 2.0E-61
sp|Q8CR20|PANB_STAES 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=panB PE=3 SV=1 67 329 2.0E-61
sp|Q5HL35|PANB_STAEQ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=panB PE=3 SV=1 67 329 2.0E-61
sp|B8DC24|PANB_LISMH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=panB PE=3 SV=1 73 336 2.0E-61
sp|A9B2U4|PANB_HERA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=panB PE=3 SV=1 65 323 2.0E-61
sp|Q6G078|PANB_BARQU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella quintana (strain Toulouse) GN=panB PE=3 SV=1 64 333 2.0E-61
sp|Q2NAY0|PANB_ERYLH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=panB PE=3 SV=1 45 329 3.0E-61
sp|Q8EIG9|PANB_SHEON 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=panB PE=3 SV=1 65 329 3.0E-61
sp|Q04XX5|PANB_LEPBL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=panB PE=3 SV=1 79 329 4.0E-61
sp|B8CTC6|PANB_SHEPW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=panB PE=3 SV=1 65 329 4.0E-61
sp|Q16DW5|PANB_ROSDO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=panB PE=3 SV=1 78 333 4.0E-61
sp|A7HYW1|PANB_PARL1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=panB PE=3 SV=1 64 335 5.0E-61
sp|B4S8V9|PANB_PROA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=panB PE=3 SV=1 66 329 7.0E-61
sp|A1KTB1|PANB_NEIMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=panB PE=3 SV=1 66 329 9.0E-61
sp|Q0AQE4|PANB_MARMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Maricaulis maris (strain MCS10) GN=panB PE=3 SV=1 57 335 9.0E-61
sp|Q0HMB1|PANB_SHESM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain MR-4) GN=panB PE=3 SV=1 65 329 1.0E-60
sp|Q2SNS0|PANB1_HAHCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=panB1 PE=3 SV=1 63 331 1.0E-60
sp|B1KEP6|PANB_SHEWM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=panB PE=3 SV=1 65 329 2.0E-60
sp|Q9JUY0|PANB_NEIMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=panB PE=3 SV=1 66 329 3.0E-60
sp|Q391N3|PANB1_BURL3 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=panB1 PE=3 SV=1 55 329 4.0E-60
sp|Q2RP30|PANB_RHORT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=panB PE=3 SV=1 81 333 4.0E-60
sp|Q0HRH6|PANB_SHESR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain MR-7) GN=panB PE=3 SV=1 65 329 5.0E-60
sp|B4RKE5|PANB_NEIG2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=panB PE=3 SV=1 66 329 5.0E-60
sp|Q5F9F9|PANB_NEIG1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=panB PE=3 SV=1 66 329 5.0E-60
sp|Q1I4P2|PANB2_PSEE4 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas entomophila (strain L48) GN=panB2 PE=3 SV=1 65 329 5.0E-60
sp|Q4A0U0|PANB_STAS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=panB PE=3 SV=1 67 329 5.0E-60
sp|Q0AB69|PANB_ALKEH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=panB PE=3 SV=1 56 329 7.0E-60
sp|Q07XZ8|PANB_SHEFN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=panB PE=3 SV=1 65 329 8.0E-60
sp|A1S3M7|PANB_SHEAM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=panB PE=3 SV=2 65 329 8.0E-60
sp|Q04VK1|PANB_LEPBJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=panB PE=3 SV=1 79 329 9.0E-60
sp|Q8ELF4|PANB_OCEIH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=panB PE=3 SV=1 68 329 9.0E-60
sp|Q8EZ98|PANB_LEPIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=panB PE=3 SV=1 79 329 1.0E-59
sp|Q72MN0|PANB_LEPIC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=panB PE=3 SV=1 79 329 1.0E-59
sp|Q6NEB7|PANB_CORDI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=panB PE=3 SV=1 64 329 2.0E-59
sp|Q9AMS0|PANB2_BRADU 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=panB2 PE=3 SV=2 55 343 2.0E-59
sp|Q12F40|PANB_POLSJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=panB PE=3 SV=1 58 323 2.0E-59
sp|B1YHQ9|PANB_EXIS2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=panB PE=3 SV=1 78 333 2.0E-59
sp|Q8UA91|PANB_AGRFC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=panB PE=3 SV=1 63 333 2.0E-59
sp|A6T221|PANB_JANMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=panB PE=3 SV=1 64 329 2.0E-59
sp|A0L0R2|PANB_SHESA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain ANA-3) GN=panB PE=3 SV=1 65 329 3.0E-59
sp|B0STK1|PANB_LEPBP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=panB PE=3 SV=1 78 329 3.0E-59
sp|B0SAC5|PANB_LEPBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=panB PE=3 SV=1 78 329 3.0E-59
sp|A4XYC4|PANB_PSEMY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas mendocina (strain ymp) GN=panB PE=3 SV=1 66 329 3.0E-59
sp|B6J9H8|PANB_COXB1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=panB PE=3 SV=1 71 329 4.0E-59
sp|Q1M4A0|PANB_RHIL3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=panB PE=3 SV=1 63 329 4.0E-59
sp|Q83EA2|PANB_COXBU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=panB PE=3 SV=1 71 329 5.0E-59
sp|A9KEG7|PANB_COXBN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=panB PE=3 SV=2 71 329 5.0E-59
sp|A1RG67|PANB_SHESW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=panB PE=3 SV=1 65 329 6.0E-59
sp|A4YA61|PANB_SHEPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=panB PE=3 SV=1 65 329 6.0E-59
sp|P38122|PANB_YEAST 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM31 PE=1 SV=1 49 344 7.0E-59
sp|Q12JC6|PANB_SHEDO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=panB PE=3 SV=1 65 328 8.0E-59
sp|Q2JZU0|PANB_RHIEC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=panB PE=3 SV=1 78 329 8.0E-59
sp|Q3AS53|PANB_CHLCH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=panB PE=3 SV=1 54 329 1.0E-58
sp|A0Q7L2|PANB_FRATN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=panB PE=3 SV=1 65 329 1.0E-58
sp|B6J1Q3|PANB_COXB2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=panB PE=3 SV=1 71 329 1.0E-58
sp|Q9ZEP8|PANB_PSEFS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=panB PE=3 SV=1 66 329 1.0E-58
sp|A4IWW6|PANB_FRATW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=panB PE=3 SV=1 79 329 1.0E-58
sp|B2SFS9|PANB_FRATM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=panB PE=3 SV=1 79 329 1.0E-58
sp|B1J2C2|PANB_PSEPW 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain W619) GN=panB PE=3 SV=1 65 329 1.0E-58
sp|B0TTI2|PANB_SHEHH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=panB PE=3 SV=1 65 329 2.0E-58
sp|Q5NF58|PANB_FRATT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=panB PE=3 SV=1 79 329 2.0E-58
sp|Q14GL1|PANB_FRAT1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=panB PE=3 SV=1 79 329 2.0E-58
sp|Q88DW9|PANB_PSEPK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain KT2440) GN=panB PE=3 SV=1 65 329 2.0E-58
sp|A5W974|PANB_PSEP1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=panB PE=3 SV=1 65 329 2.0E-58
sp|Q0BMQ5|PANB_FRATO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=panB PE=3 SV=2 79 329 2.0E-58
sp|Q2A4C6|PANB_FRATH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=panB PE=3 SV=2 79 329 2.0E-58
sp|A7NB32|PANB_FRATF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=panB PE=3 SV=1 79 329 2.0E-58
sp|Q1J1C0|PANB_DEIGD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=panB PE=3 SV=1 81 333 2.0E-58
sp|Q30PX5|PANB_SULDN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=panB PE=3 SV=1 64 329 2.0E-58
sp|Q9JZW6|PANB_NEIMB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=panB PE=1 SV=1 66 329 3.0E-58
sp|Q2S8W3|PANB2_HAHCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Hahella chejuensis (strain KCTC 2396) GN=panB2 PE=3 SV=1 66 331 5.0E-58
sp|Q4K5Y4|PANB2_PSEF5 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=panB2 PE=3 SV=1 66 329 5.0E-58
sp|A8H0D4|PANB_SHEPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=panB PE=3 SV=1 65 329 5.0E-58
sp|A1VKS3|PANB_POLNA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=panB PE=3 SV=2 58 323 6.0E-58
sp|Q7M878|PANB_WOLSU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=panB PE=3 SV=1 64 329 6.0E-58
sp|B6IX34|PANB_RHOCS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=panB PE=3 SV=1 81 334 1.0E-57
sp|Q5PBP6|PANB_ANAMM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaplasma marginale (strain St. Maries) GN=panB PE=3 SV=1 79 329 1.0E-57
sp|B9KHN0|PANB_ANAMF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Anaplasma marginale (strain Florida) GN=panB PE=3 SV=1 79 329 1.0E-57
sp|Q17WP8|PANB_HELAH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter acinonychis (strain Sheeba) GN=panB PE=3 SV=1 64 329 1.0E-57
sp|A0AXR0|PANB2_BURCH 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia cenocepacia (strain HI2424) GN=panB2 PE=3 SV=1 63 329 1.0E-57
sp|Q5X1M8|PANB_LEGPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Paris) GN=panB PE=3 SV=1 81 329 2.0E-57
sp|O67783|PANB_AQUAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aquifex aeolicus (strain VF5) GN=panB PE=3 SV=1 66 329 2.0E-57
sp|Q21U09|PANB_RHOFT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=panB PE=3 SV=1 53 323 2.0E-57
sp|A8EVP8|PANB_ARCB4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Arcobacter butzleri (strain RM4018) GN=panB PE=3 SV=1 81 329 2.0E-57
sp|Q0C444|PANB_HYPNA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=panB PE=3 SV=1 81 333 2.0E-57
sp|Q47B66|PANB_DECAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Dechloromonas aromatica (strain RCB) GN=panB PE=3 SV=1 64 329 2.0E-57
sp|B4RYN8|PANB_ALTMD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=panB1 PE=3 SV=1 64 329 2.0E-57
sp|Q5ZS58|PANB_LEGPH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=panB PE=3 SV=2 82 329 2.0E-57
sp|Q3ILK1|PANB_PSEHT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=panB PE=3 SV=1 65 329 2.0E-57
sp|A6Q1X8|PANB_NITSB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=panB PE=3 SV=1 63 329 3.0E-57
sp|Q1CUB6|PANB_HELPH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain HPAG1) GN=panB PE=3 SV=1 57 329 3.0E-57
sp|C1CX98|PANB_DEIDV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=panB PE=3 SV=1 81 333 4.0E-57
sp|Q5NXQ3|PANB_AROAE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=panB PE=3 SV=1 64 329 4.0E-57
sp|Q0K762|PANB_CUPNH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=panB PE=3 SV=2 63 329 4.0E-57
sp|O25698|PANB_HELPY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=panB PE=3 SV=1 57 329 5.0E-57
sp|B3R6G5|PANB_CUPTR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=panB PE=3 SV=1 63 329 5.0E-57
sp|A0RN82|PANB_CAMFF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=panB PE=3 SV=1 64 329 5.0E-57
sp|Q3INP4|PANB_NATPD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=panB PE=3 SV=1 81 335 5.0E-57
sp|Q8A9W7|PANB_BACTN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=panB PE=3 SV=1 64 329 6.0E-57
sp|Q5WTD7|PANB_LEGPL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Lens) GN=panB PE=3 SV=1 82 329 6.0E-57
sp|B5ZAF6|PANB_HELPG 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain G27) GN=panB PE=3 SV=1 57 329 8.0E-57
sp|A1B2L0|PANB_PARDP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=panB PE=3 SV=1 60 329 1.0E-56
sp|Q3K6Q6|PANB_PSEPF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=panB PE=3 SV=1 66 329 1.0E-56
sp|Q605H0|PANB_METCA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=panB PE=3 SV=1 66 329 1.0E-56
sp|A5IAR5|PANB_LEGPC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Legionella pneumophila (strain Corby) GN=panB PE=3 SV=1 81 329 1.0E-56
sp|P52997|PANB_SYNY3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=panB PE=3 SV=1 81 325 1.0E-56
sp|Q47W60|PANB_COLP3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=panB PE=3 SV=1 65 329 2.0E-56
sp|B6JKW5|PANB_HELP2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain P12) GN=panB PE=3 SV=1 57 329 2.0E-56
sp|Q5QVR5|PANB_IDILO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=panB PE=3 SV=1 65 329 2.0E-56
sp|Q9ZM56|PANB_HELPJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=panB PE=3 SV=1 57 329 2.0E-56
sp|Q9HPT6|PANB_HALSA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=panB PE=3 SV=1 79 329 2.0E-56
sp|B0R5P8|PANB_HALS3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=panB PE=3 SV=1 79 329 2.0E-56
sp|A7NG79|PANB_ROSCS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=panB PE=3 SV=1 63 345 4.0E-56
sp|Q02FU3|PANB2_PSEAB 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=panB2 PE=3 SV=1 66 329 5.0E-56
sp|Q0B4Z6|PANB2_BURCM 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=panB2 PE=3 SV=1 63 329 6.0E-56
sp|A5URA8|PANB_ROSS1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Roseiflexus sp. (strain RS-1) GN=panB PE=3 SV=1 63 345 8.0E-56
sp|A7GZP8|PANB_CAMC5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter curvus (strain 525.92) GN=panB PE=3 SV=1 60 330 1.0E-55
sp|Q6MHI3|PANB_BDEBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=panB PE=3 SV=1 68 329 1.0E-55
sp|Q9HV70|PANB2_PSEAE 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panB2 PE=3 SV=1 66 329 2.0E-55
sp|A9BV02|PANB_DELAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=panB PE=3 SV=1 44 323 3.0E-55
sp|B2USM4|PANB_HELPS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter pylori (strain Shi470) GN=panB PE=3 SV=1 57 329 3.0E-55
sp|A1US40|PANB_BARBK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=panB PE=3 SV=1 64 331 3.0E-55
sp|A4VPM6|PANB_PSEU5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=panB PE=3 SV=2 66 329 3.0E-55
sp|A4YED8|PANB_METS5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=panB PE=3 SV=1 70 327 1.0E-54
sp|A0LTD0|PANB_ACIC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=panB PE=3 SV=1 64 329 1.0E-54
sp|Q7VIU7|PANB_HELHP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=panB PE=3 SV=1 64 329 2.0E-54
sp|A6W2I3|PANB_MARMS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Marinomonas sp. (strain MWYL1) GN=panB PE=3 SV=1 64 329 2.0E-54
sp|Q7UM39|PANB_RHOBA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=panB PE=3 SV=1 63 329 2.0E-54
sp|Q98NC9|PANB_RHILO 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Rhizobium loti (strain MAFF303099) GN=panB PE=3 SV=1 81 334 3.0E-54
sp|Q1QEJ4|PANB_PSYCK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=panB PE=3 SV=1 67 329 4.0E-54
sp|Q2J886|PANB_FRASC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Frankia sp. (strain CcI3) GN=panB PE=3 SV=1 53 329 1.0E-53
sp|C4L929|PANB_TOLAT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=panB PE=3 SV=1 65 329 2.0E-53
sp|A1AW70|PANB_RUTMC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=panB PE=3 SV=1 66 329 2.0E-53
sp|B0UQT7|PANB_METS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacterium sp. (strain 4-46) GN=panB PE=3 SV=1 66 340 2.0E-53
sp|A1TYE6|PANB_MARHV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=panB PE=3 SV=1 66 329 2.0E-53
sp|A5CX20|PANB_VESOH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=panB PE=3 SV=1 66 329 3.0E-53
sp|A1WBI7|PANB_ACISJ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidovorax sp. (strain JS42) GN=panB PE=3 SV=1 53 323 3.0E-53
sp|Q7N869|PANB_PHOLL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=panB PE=3 SV=1 64 329 4.0E-53
sp|C3LS82|PANB_VIBCM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=panB PE=3 SV=1 64 328 5.0E-53
sp|Q9KUD0|PANB_VIBCH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=panB PE=3 SV=1 64 328 5.0E-53
sp|A5F975|PANB_VIBC3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=panB PE=3 SV=1 64 328 5.0E-53
sp|A5WHD0|PANB_PSYWF 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=panB PE=3 SV=1 66 329 5.0E-53
sp|Q0VSR3|PANB_ALCBS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=panB PE=3 SV=1 66 329 7.0E-53
sp|Q7VV53|PANB_BORPE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=panB PE=3 SV=1 61 327 9.0E-53
sp|Q7W3E7|PANB_BORPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=panB PE=3 SV=1 61 327 9.0E-53
sp|Q7WER7|PANB_BORBR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=panB PE=3 SV=1 61 327 9.0E-53
sp|Q4K629|PANB1_PSEF5 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=panB1 PE=3 SV=1 100 333 9.0E-53
sp|A1TTV9|PANB_ACIAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=panB PE=3 SV=1 53 323 9.0E-53
sp|Q4ZY86|PANB_PSEU2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=panB PE=3 SV=1 65 329 1.0E-52
sp|Q5DZU8|PANB2_VIBF1 3-methyl-2-oxobutanoate hydroxymethyltransferase 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=panB2 PE=3 SV=2 64 329 1.0E-52
sp|Q4FVG8|PANB_PSYA2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=panB PE=3 SV=1 67 329 1.0E-52
sp|B5ES07|PANB_ACIF5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=panB PE=3 SV=1 83 325 2.0E-52
sp|B7JBM8|PANB_ACIF2 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=panB PE=3 SV=1 83 325 2.0E-52
sp|Q2NVR2|PANB_SODGM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Sodalis glossinidius (strain morsitans) GN=panB PE=3 SV=1 67 329 2.0E-52
sp|B7VK03|PANB_VIBTL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=panB PE=3 SV=1 64 328 2.0E-52
sp|Q1H3S0|PANB_METFK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=panB PE=3 SV=1 66 329 3.0E-52
sp|Q31FF5|PANB_THICR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=panB PE=3 SV=1 66 327 3.0E-52
sp|Q1I9K4|PANB1_PSEE4 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Pseudomonas entomophila (strain L48) GN=panB1 PE=3 SV=1 60 329 3.0E-52
sp|Q15NV5|PANB_PSEA6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=panB PE=3 SV=1 64 329 3.0E-52
sp|B1Y4K8|PANB_LEPCP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=panB PE=3 SV=1 50 323 3.0E-52
sp|A7MYX2|PANB_VIBCB 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=panB PE=3 SV=1 64 328 4.0E-52
sp|A7ZEL6|PANB_CAMC1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Campylobacter concisus (strain 13826) GN=panB PE=3 SV=1 63 330 7.0E-52
sp|A1SSG9|PANB_PSYIN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Psychromonas ingrahamii (strain 37) GN=panB PE=3 SV=1 65 329 7.0E-52
sp|Q48N86|PANB_PSE14 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=panB PE=3 SV=1 65 329 7.0E-52
sp|Q6F854|PANB_ACIAD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=panB PE=3 SV=2 66 332 7.0E-52
sp|Q1QSZ9|PANB_CHRSD 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=panB PE=3 SV=1 64 329 8.0E-52
sp|Q83GK7|PANB_TROWT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tropheryma whipplei (strain Twist) GN=panB PE=3 SV=1 84 327 1.0E-51
sp|Q87LV2|PANB_VIBPA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=panB PE=3 SV=1 64 328 2.0E-51
sp|Q83HM1|PANB_TROW8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=panB PE=3 SV=1 84 327 2.0E-51
sp|A1WDW4|PANB_VEREI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=panB PE=3 SV=2 56 323 2.0E-51
sp|Q5V3P6|PANB_HALMA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=panB PE=3 SV=2 70 333 4.0E-51
sp|Q6LMJ6|PANB_PHOPR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Photobacterium profundum GN=panB PE=3 SV=1 64 329 4.0E-51
sp|Q888Q5|PANB_PSESM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=panB PE=3 SV=1 65 329 8.0E-51
sp|B5YZH1|PANB_ECO5E 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=panB PE=3 SV=1 64 329 2.0E-50
sp|Q8X929|PANB_ECO57 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O157:H7 GN=panB PE=3 SV=1 64 329 2.0E-50
sp|A7MGP6|PANB_CROS8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=panB PE=3 SV=1 64 329 3.0E-50
sp|Q6D1X6|PANB_PECAS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=panB PE=3 SV=1 64 329 4.0E-50
sp|A9MPM1|PANB_SALAR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=panB PE=3 SV=1 64 329 2.0E-49
sp|Q5NL34|PANB1_ZYMMO 3-methyl-2-oxobutanoate hydroxymethyltransferase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=panB1 PE=3 SV=2 60 323 2.0E-49
sp|Q2P377|PANB_XANOM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=panB PE=3 SV=1 78 329 2.0E-49
sp|Q8PLL1|PANB_XANAC 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=panB PE=3 SV=1 64 329 3.0E-49
sp|B6ELE1|PANB_ALISL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=panB PE=3 SV=1 64 329 4.0E-49
sp|B5FB05|PANB_VIBFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Vibrio fischeri (strain MJ11) GN=panB PE=3 SV=1 64 329 4.0E-49
sp|Q5H0A3|PANB_XANOR 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=panB PE=3 SV=1 78 329 5.0E-49
sp|B2SJL8|PANB_XANOP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=panB PE=3 SV=1 78 329 5.0E-49
sp|Q32JW9|PANB_SHIDS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=panB PE=3 SV=1 64 329 5.0E-49
sp|B7N804|PANB_ECOLU 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=panB PE=3 SV=1 64 329 6.0E-49
sp|B0U1Q2|PANB_XYLFM 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xylella fastidiosa (strain M12) GN=panB PE=3 SV=1 61 329 1.0E-48
sp|Q83ME5|PANB_SHIFL 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella flexneri GN=panB PE=3 SV=1 64 329 1.0E-48
sp|Q0T867|PANB_SHIF8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=panB PE=3 SV=1 64 329 1.0E-48
sp|B7LW41|PANB_ESCF3 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|A1JJN8|PANB_YERE8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=panB PE=3 SV=2 64 329 2.0E-48
sp|Q3BUL6|PANB_XANC5 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=panB PE=3 SV=1 77 329 2.0E-48
sp|B6HZA9|PANB_ECOSE 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli (strain SE11) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|A7ZW83|PANB_ECOHS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|B7LGJ6|PANB_ECO55 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|A7ZHM4|PANB_ECO24 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|Q8P9T0|PANB_XANCP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|Q4UTV5|PANB_XANC8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=panB PE=3 SV=1 64 329 2.0E-48
sp|A4SJ61|PANB_AERS4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeromonas salmonicida (strain A449) GN=panB PE=3 SV=1 65 329 3.0E-48
sp|A8ALE9|PANB_CITK8 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=panB PE=3 SV=1 64 329 3.0E-48
sp|B7M175|PANB_ECO8A 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=panB PE=3 SV=1 64 329 3.0E-48
sp|Q1RG56|PANB_ECOUT 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=panB PE=3 SV=1 64 329 3.0E-48
sp|Q8FL30|PANB_ECOL6 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=panB PE=3 SV=1 64 329 3.0E-48
sp|A1A7I0|PANB_ECOK1 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O1:K1 / APEC GN=panB PE=3 SV=1 64 329 3.0E-48
sp|B7MBB7|PANB_ECO45 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=panB PE=3 SV=1 64 329 3.0E-48
sp|A4W6N8|PANB_ENT38 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Enterobacter sp. (strain 638) GN=panB PE=3 SV=1 64 329 4.0E-48
sp|Q8Z9D2|PANB_SALTI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella typhi GN=panB PE=3 SV=1 64 329 4.0E-48
sp|B0VKK4|PANB_ACIBS 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Acinetobacter baumannii (strain SDF) GN=panB PE=3 SV=1 66 332 4.0E-48
sp|C6DC47|PANB_PECCP 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=panB PE=3 SV=1 64 329 4.0E-48
sp|A0KP07|PANB_AERHH 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=panB PE=3 SV=1 65 329 4.0E-48
sp|Q8ZRR0|PANB_SALTY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=panB PE=3 SV=1 64 329 5.0E-48
sp|B5BL65|PANB_SALPK 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=panB PE=3 SV=1 64 329 5.0E-48
[Show less]

GO

GO Term Description Terminal node
GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity Yes
GO:0015940 pantothenate biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0043603 cellular amide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0015939 pantothenate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006766 vitamin metabolic process No
GO:0016742 hydroxymethyl-, formyl- and related transferase activity No
GO:0008152 metabolic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0009058 biosynthetic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0044283 small molecule biosynthetic process No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1309
MGPTSFARLNALRSIMGIAAPARPRAALGGAGRTCASGAAWTCLSQIRCSSHSPMGSPPATPRKKVTLGTLRSLH
AKGDAITVVTAHDFPSAHAADHAGMDIVLVGDSLAMVALGMEDTSEIVLEDMLLHCRSVARATKAAFTVGDLPMG
SYEVSPQQALSAAIRVIKEGRVQAVKLEGGAEMAPTIGKITSAGIPVLAHVGLTPQRQNALGGFRVQGKTSEGAL
RVLADARAVQDAGAFAVVIEAVPPEVAALVTRKLSIPTIGIGAGAGCSGQVLVQTDMIGNFPPGRFLPKFVKQYG
NVWAETMRALEAYRDDVKSRKYPAREHTYPISEAEFAAFSNAVEGQ*
Coding >OphauB2|1309
ATGGGCCCGACCAGTTTTGCCCGCCTCAATGCCCTGCGCTCCATCATGGGCATTGCAGCTCCGGCTCGTCCCCGC
GCTGCCCTGGGGGGTGCCGGACGCACATGTGCAAGCGGCGCAGCGTGGACATGTCTCTCCCAAATTCGATGCAGC
TCTCATTCCCCCATGGGGTCGCCTCCAGCCACCCCCCGCAAAAAAGTGACGCTAGGCACGCTGCGCTCTCTGCAC
GCCAAAGGCGACGCCATAACCGTCGTCACGGCCCATGATTTCCCCAGCGCCCATGCTGCAGACCATGCGGGCATG
GACATTGTATTGGTTGGCGACAGTCTGGCCATGGTGGCTCTGGGTATGGAGGACACGAGTGAGATTGTACTTGAA
GACATGCTACTGCACTGCCGGTCCGTTGCTCGCGCCACCAAGGCCGCCTTTACTGTTGGCGACTTGCCCATGGGC
TCGTACGAAGTGTCTCCCCAACAGGCCCTCAGCGCTGCCATTCGAGTCATCAAGGAGGGCCGCGTGCAAGCCGTC
AAGCTCGAAGGCGGCGCCGAGATGGCTCCCACCATTGGCAAAATCACGTCGGCTGGCATTCCCGTCCTTGCGCAC
GTTGGCCTGACGCCCCAGCGCCAAAATGCCCTGGGCGGCTTCCGTGTCCAGGGCAAGACAAGTGAGGGCGCTCTG
CGCGTGCTGGCCGATGCGCGTGCCGTGCAGGACGCCGGCGCCTTTGCCGTTGTCATTGAGGCGGTGCCCCCTGAA
GTGGCAGCTCTCGTAACACGCAAGCTCTCCATTCCAACCATTGGCATTGGTGCCGGGGCCGGCTGCTCAGGCCAG
GTGCTCGTCCAGACCGACATGATTGGCAACTTTCCCCCTGGCCGTTTCCTGCCCAAGTTTGTCAAGCAGTATGGC
AATGTCTGGGCAGAGACGATGCGCGCTCTCGAGGCCTACCGCGACGATGTCAAGAGCCGCAAGTATCCAGCTCGC
GAGCACACATATCCCATTTCTGAAGCAGAGTTTGCTGCTTTCTCAAATGCCGTTGAAGGGCAGTAG
Transcript >OphauB2|1309
ATGGGCCCGACCAGTTTTGCCCGCCTCAATGCCCTGCGCTCCATCATGGGCATTGCAGCTCCGGCTCGTCCCCGC
GCTGCCCTGGGGGGTGCCGGACGCACATGTGCAAGCGGCGCAGCGTGGACATGTCTCTCCCAAATTCGATGCAGC
TCTCATTCCCCCATGGGGTCGCCTCCAGCCACCCCCCGCAAAAAAGTGACGCTAGGCACGCTGCGCTCTCTGCAC
GCCAAAGGCGACGCCATAACCGTCGTCACGGCCCATGATTTCCCCAGCGCCCATGCTGCAGACCATGCGGGCATG
GACATTGTATTGGTTGGCGACAGTCTGGCCATGGTGGCTCTGGGTATGGAGGACACGAGTGAGATTGTACTTGAA
GACATGCTACTGCACTGCCGGTCCGTTGCTCGCGCCACCAAGGCCGCCTTTACTGTTGGCGACTTGCCCATGGGC
TCGTACGAAGTGTCTCCCCAACAGGCCCTCAGCGCTGCCATTCGAGTCATCAAGGAGGGCCGCGTGCAAGCCGTC
AAGCTCGAAGGCGGCGCCGAGATGGCTCCCACCATTGGCAAAATCACGTCGGCTGGCATTCCCGTCCTTGCGCAC
GTTGGCCTGACGCCCCAGCGCCAAAATGCCCTGGGCGGCTTCCGTGTCCAGGGCAAGACAAGTGAGGGCGCTCTG
CGCGTGCTGGCCGATGCGCGTGCCGTGCAGGACGCCGGCGCCTTTGCCGTTGTCATTGAGGCGGTGCCCCCTGAA
GTGGCAGCTCTCGTAACACGCAAGCTCTCCATTCCAACCATTGGCATTGGTGCCGGGGCCGGCTGCTCAGGCCAG
GTGCTCGTCCAGACCGACATGATTGGCAACTTTCCCCCTGGCCGTTTCCTGCCCAAGTTTGTCAAGCAGTATGGC
AATGTCTGGGCAGAGACGATGCGCGCTCTCGAGGCCTACCGCGACGATGTCAAGAGCCGCAAGTATCCAGCTCGC
GAGCACACATATCCCATTTCTGAAGCAGAGTTTGCTGCTTTCTCAAATGCCGTTGAAGGGCAGTAG
Gene >OphauB2|1309
ATGGGCCCGACCAGTTTTGCCCGCCTCAATGCCCTGCGCTCCATCATGGGCATTGCAGCTCCGGCTCGTCCCCGC
GCTGCCCTGGGGGGTGCCGGACGCACATGTGCAAGCGGCGCAGCGTGGACATGTCTCTCCCAAATTCGATGCAGC
TCTCATTCCCCCATGGGGTCGCCTCCAGCCACCCCCCGCAAAAAAGTGACGCTAGGCACGCTGCGCTCTCTGCAC
GCCAAAGGCGACGCCATAACCGTCGTCACGGCCCATGATTTCCCCAGCGCCCATGCTGCAGACCATGCGGGCATG
GACATTGTATTGGTTGGCGACAGTCTGGCCATGGTGGCTCTGGGTATGGAGGACACGAGTGAGATTGTACTTGAA
GACATGCTACTGCACTGCCGGTCCGTTGCTCGCGCCACCAAGGCCGCCTTTACTGTAAGTCAAAAGACCTCATTG
CTGTGATACAACGCGCGTGCTTACCTCCATGCTATGCAGGTTGGCGACTTGCCCATGGGCTCGTACGAAGTGTCT
CCCCAACAGGCCCTCAGCGCTGCCATTCGAGTCATCAAGGAGGGCCGCGTGCAAGCCGTCAAGCTCGAAGGCGGC
GCCGAGATGGCTCCCACCATTGGCAAAATCACGTCGGCTGGCATTCCCGTCCTTGCGCACGTTGGCCTGACGCCC
CAGCGCCAAAATGCCCTGGGCGGCTTCCGTGTCCAGGGCAAGACAAGTGAGGGCGCTCTGCGCGTGCTGGCCGAT
GCGCGTGCCGTGCAGGACGCCGGCGCCTTTGCCGTTGTCATTGAGGCGGTGCCCCCTGAAGTGGCAGCTCTCGTA
ACACGCAAGCTCTCCATTCCAACCATTGGCATTGGTGCCGGGGCCGGCTGCTCAGGCCAGGTGCTCGTCCAGACC
GACATGATTGGCAACTTTCCCCCTGGCCGTTTCCTGCCCAAGTTTGTCAAGCAGTATGGCAATGTCTGGGCAGAG
ACGATGCGCGCTCTCGAGGCCTACCGCGACGATGTCAAGAGCCGCAAGTATCCAGCTCGCGAGCACACATATCCC
ATTTCTGAAGCAGAGTTTGCTGCTTTCTCAAATGCCGTTGAAGGGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail