Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1308
Gene name
LocationContig_131:27462..29990
Strand-
Gene length (bp)2528
Transcript length (bp)2466
Coding sequence length (bp)2466
Protein length (aa) 822

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46679|STB2_YEAST Protein STB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB2 PE=1 SV=2 14 418 7.0E-49
sp|P36085|STB6_YEAST Protein STB6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB6 PE=1 SV=1 14 406 4.0E-43

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1308
MTMQDQKPTDASIPRQNIVVPDPVALRFLQQDACVQVVQPKTRLRGYELYVVEQWACSRQSPTVVVVTFTGDETH
FIYTGVITVPRDEGLWSPRLRVYLTAAHQHHARAKQTNLGEIVVTNLSNFPSALTVIPVPDGDVSKHRQLFFVNE
DLKRLGCSGRSGLILSEPAEATQAKFQQLYRTSDRIPFWSSVTELVKLCQVALYLFDKLDYEYIDGLLCDMTETA
IGNWWTELGAEHYNFEPSDGILGPCTVAALLGMLMGARNRLHWYGAPVSKDVFDIESTKRGIGYFQKQQKLEKKR
RLDRQTLFRLHKVTAKAVAADGWGVQKAVKSTVSEIGGKRGEIVLDMVSRDKGGIADIETLDIDTFVHLVYGARP
KWLWHGKARRSTAEIQEFEFGTGNAMLSRNEATGQLAKRSQSLPLDEELEAKKDETLSAVAGFAGPSCDNSTDRE
ASKKAVFKSVAGKMSDRIKDAVGGGRRGQAGRQSTPAREEETGSTGLALSNTSQAILASSPVAVGRVFTWRPKPE
EEQAATRRSDTAASLTVLESWRGADLSTLDDKLASRSTDRETALDNKSAQAHQAPPPQAPAQADDKDANGEGMPS
GECKMNNQRPTVFRRRSCGVSDVSCKHVVNENRWARHMSFGDAQAAILTWEEVVDFDDTTGGLESLDARAAEAER
LSRLVNGMEQAIGPWVEDKVKTIEALDERYARDTGELQELYQQMSEACKSVRHSSDELLASQRATLAESVKEIEV
LVARLEYEMDNLASKVRDVDDGIENFEQLVEGVEERAEELKTQLETESWLHWLVRTMTGVGTGPNVTRGAP*
Coding >OphauB2|1308
ATGACGATGCAAGACCAGAAACCGACAGACGCGTCAATTCCTCGGCAGAATATTGTGGTCCCCGATCCCGTCGCC
TTGAGATTCCTTCAACAAGATGCCTGCGTACAGGTTGTTCAACCCAAGACTCGTTTACGCGGATACGAGCTTTAT
GTCGTTGAGCAATGGGCCTGCTCAAGACAGTCGCCGACTGTTGTCGTTGTGACCTTTACCGGAGACGAGACGCAC
TTTATATACACTGGCGTCATCACAGTCCCTCGAGATGAGGGACTCTGGTCTCCGCGCTTGCGCGTCTATCTTACT
GCTGCTCACCAGCACCATGCTCGAGCCAAACAGACCAATCTAGGAGAAATCGTCGTGACCAATCTGAGCAATTTC
CCCTCGGCACTTACCGTTATTCCCGTACCGGATGGAGATGTATCAAAACATCGGCAGCTCTTCTTTGTCAATGAA
GACTTGAAACGACTTGGCTGCTCCGGCCGCTCAGGCCTTATTCTATCTGAGCCTGCCGAGGCCACACAGGCCAAG
TTTCAGCAACTCTACCGGACCAGCGATCGAATCCCCTTCTGGTCATCAGTCACAGAACTCGTCAAACTGTGCCAA
GTCGCCCTTTATTTGTTCGACAAGCTTGATTATGAATATATAGATGGACTCTTGTGCGACATGACCGAGACTGCC
ATTGGCAACTGGTGGACAGAACTTGGTGCCGAGCATTACAACTTTGAACCTTCTGACGGCATCCTAGGTCCTTGT
ACCGTGGCCGCTTTGCTAGGCATGCTCATGGGGGCAAGGAATCGACTACATTGGTATGGCGCTCCTGTCTCCAAA
GATGTCTTTGACATTGAAAGCACCAAACGAGGCATTGGATACTTCCAGAAGCAGCAAAAGCTGGAAAAGAAGCGA
CGTTTGGACCGTCAGACATTATTCAGGCTTCACAAGGTTACCGCAAAAGCAGTTGCCGCAGACGGCTGGGGGGTG
CAAAAGGCAGTCAAGTCGACAGTGTCCGAGATTGGTGGGAAAAGAGGAGAAATTGTGCTCGACATGGTTTCCAGG
GATAAAGGAGGCATTGCGGACATTGAGACACTTGACATTGACACCTTTGTTCATCTCGTCTATGGCGCGCGCCCA
AAATGGCTTTGGCATGGCAAAGCCAGAAGAAGTACCGCAGAAATACAAGAATTCGAATTTGGTACCGGCAACGCC
ATGTTGTCAAGAAACGAAGCTACTGGTCAGCTAGCAAAACGAAGCCAGTCATTGCCCTTAGATGAAGAACTCGAG
GCCAAGAAGGATGAGACGTTGAGTGCAGTAGCTGGATTCGCCGGCCCCTCTTGTGATAACTCGACGGATCGAGAA
GCATCAAAGAAGGCAGTCTTCAAGAGTGTTGCTGGAAAAATGAGTGATCGGATCAAGGACGCCGTCGGTGGGGGC
CGCCGAGGTCAAGCCGGCCGTCAGTCAACCCCAGCTAGAGAGGAGGAAACGGGAAGCACAGGGCTTGCCCTGAGC
AACACATCGCAGGCTATCTTAGCTTCGAGTCCTGTCGCTGTAGGCCGAGTCTTTACTTGGCGACCCAAGCCAGAA
GAAGAACAAGCTGCCACGAGACGAAGCGATACTGCTGCGTCCCTAACCGTTTTGGAATCATGGCGAGGGGCCGAC
TTGTCTACCCTGGATGACAAGTTGGCATCGCGTTCAACAGACAGGGAAACTGCTCTGGACAATAAATCGGCACAA
GCGCACCAGGCGCCGCCGCCGCAAGCACCGGCACAAGCTGACGACAAGGACGCGAATGGAGAGGGCATGCCGAGC
GGCGAGTGCAAGATGAATAACCAAAGACCAACTGTGTTCCGACGTCGCAGCTGCGGCGTTTCCGATGTCTCGTGC
AAGCATGTCGTCAATGAGAATCGGTGGGCCCGTCACATGTCATTTGGAGACGCACAAGCAGCCATCTTGACATGG
GAGGAGGTTGTTGACTTTGACGACACTACTGGGGGCCTCGAGTCTCTTGACGCTCGCGCCGCAGAAGCTGAGCGC
CTGAGCCGGCTTGTGAATGGAATGGAGCAAGCAATTGGGCCATGGGTCGAGGACAAGGTCAAGACGATTGAAGCG
CTGGACGAGCGGTATGCACGCGACACTGGCGAGCTGCAGGAGCTCTACCAACAGATGAGTGAGGCATGCAAGAGT
GTGCGGCACAGCTCGGATGAACTTTTGGCTTCACAGCGAGCCACCCTGGCGGAGAGCGTCAAGGAGATTGAGGTA
CTGGTGGCGCGACTCGAATACGAAATGGATAATTTGGCGTCAAAGGTGCGAGACGTGGACGACGGCATTGAAAAC
TTTGAGCAGCTGGTTGAGGGCGTCGAGGAACGCGCCGAGGAGCTCAAGACGCAGCTCGAGACGGAGTCTTGGCTG
CACTGGCTCGTCAGGACCATGACGGGCGTGGGAACAGGGCCCAATGTGACGCGAGGAGCCCCATGA
Transcript >OphauB2|1308
ATGACGATGCAAGACCAGAAACCGACAGACGCGTCAATTCCTCGGCAGAATATTGTGGTCCCCGATCCCGTCGCC
TTGAGATTCCTTCAACAAGATGCCTGCGTACAGGTTGTTCAACCCAAGACTCGTTTACGCGGATACGAGCTTTAT
GTCGTTGAGCAATGGGCCTGCTCAAGACAGTCGCCGACTGTTGTCGTTGTGACCTTTACCGGAGACGAGACGCAC
TTTATATACACTGGCGTCATCACAGTCCCTCGAGATGAGGGACTCTGGTCTCCGCGCTTGCGCGTCTATCTTACT
GCTGCTCACCAGCACCATGCTCGAGCCAAACAGACCAATCTAGGAGAAATCGTCGTGACCAATCTGAGCAATTTC
CCCTCGGCACTTACCGTTATTCCCGTACCGGATGGAGATGTATCAAAACATCGGCAGCTCTTCTTTGTCAATGAA
GACTTGAAACGACTTGGCTGCTCCGGCCGCTCAGGCCTTATTCTATCTGAGCCTGCCGAGGCCACACAGGCCAAG
TTTCAGCAACTCTACCGGACCAGCGATCGAATCCCCTTCTGGTCATCAGTCACAGAACTCGTCAAACTGTGCCAA
GTCGCCCTTTATTTGTTCGACAAGCTTGATTATGAATATATAGATGGACTCTTGTGCGACATGACCGAGACTGCC
ATTGGCAACTGGTGGACAGAACTTGGTGCCGAGCATTACAACTTTGAACCTTCTGACGGCATCCTAGGTCCTTGT
ACCGTGGCCGCTTTGCTAGGCATGCTCATGGGGGCAAGGAATCGACTACATTGGTATGGCGCTCCTGTCTCCAAA
GATGTCTTTGACATTGAAAGCACCAAACGAGGCATTGGATACTTCCAGAAGCAGCAAAAGCTGGAAAAGAAGCGA
CGTTTGGACCGTCAGACATTATTCAGGCTTCACAAGGTTACCGCAAAAGCAGTTGCCGCAGACGGCTGGGGGGTG
CAAAAGGCAGTCAAGTCGACAGTGTCCGAGATTGGTGGGAAAAGAGGAGAAATTGTGCTCGACATGGTTTCCAGG
GATAAAGGAGGCATTGCGGACATTGAGACACTTGACATTGACACCTTTGTTCATCTCGTCTATGGCGCGCGCCCA
AAATGGCTTTGGCATGGCAAAGCCAGAAGAAGTACCGCAGAAATACAAGAATTCGAATTTGGTACCGGCAACGCC
ATGTTGTCAAGAAACGAAGCTACTGGTCAGCTAGCAAAACGAAGCCAGTCATTGCCCTTAGATGAAGAACTCGAG
GCCAAGAAGGATGAGACGTTGAGTGCAGTAGCTGGATTCGCCGGCCCCTCTTGTGATAACTCGACGGATCGAGAA
GCATCAAAGAAGGCAGTCTTCAAGAGTGTTGCTGGAAAAATGAGTGATCGGATCAAGGACGCCGTCGGTGGGGGC
CGCCGAGGTCAAGCCGGCCGTCAGTCAACCCCAGCTAGAGAGGAGGAAACGGGAAGCACAGGGCTTGCCCTGAGC
AACACATCGCAGGCTATCTTAGCTTCGAGTCCTGTCGCTGTAGGCCGAGTCTTTACTTGGCGACCCAAGCCAGAA
GAAGAACAAGCTGCCACGAGACGAAGCGATACTGCTGCGTCCCTAACCGTTTTGGAATCATGGCGAGGGGCCGAC
TTGTCTACCCTGGATGACAAGTTGGCATCGCGTTCAACAGACAGGGAAACTGCTCTGGACAATAAATCGGCACAA
GCGCACCAGGCGCCGCCGCCGCAAGCACCGGCACAAGCTGACGACAAGGACGCGAATGGAGAGGGCATGCCGAGC
GGCGAGTGCAAGATGAATAACCAAAGACCAACTGTGTTCCGACGTCGCAGCTGCGGCGTTTCCGATGTCTCGTGC
AAGCATGTCGTCAATGAGAATCGGTGGGCCCGTCACATGTCATTTGGAGACGCACAAGCAGCCATCTTGACATGG
GAGGAGGTTGTTGACTTTGACGACACTACTGGGGGCCTCGAGTCTCTTGACGCTCGCGCCGCAGAAGCTGAGCGC
CTGAGCCGGCTTGTGAATGGAATGGAGCAAGCAATTGGGCCATGGGTCGAGGACAAGGTCAAGACGATTGAAGCG
CTGGACGAGCGGTATGCACGCGACACTGGCGAGCTGCAGGAGCTCTACCAACAGATGAGTGAGGCATGCAAGAGT
GTGCGGCACAGCTCGGATGAACTTTTGGCTTCACAGCGAGCCACCCTGGCGGAGAGCGTCAAGGAGATTGAGGTA
CTGGTGGCGCGACTCGAATACGAAATGGATAATTTGGCGTCAAAGGTGCGAGACGTGGACGACGGCATTGAAAAC
TTTGAGCAGCTGGTTGAGGGCGTCGAGGAACGCGCCGAGGAGCTCAAGACGCAGCTCGAGACGGAGTCTTGGCTG
CACTGGCTCGTCAGGACCATGACGGGCGTGGGAACAGGGCCCAATGTGACGCGAGGAGCCCCATGA
Gene >OphauB2|1308
ATGACGATGCAAGACCAGAAACCGACAGACGCGTCAATTCCTCGGCAGAATATTGTGGTCCCCGATCCCGTCGCC
TTGAGGTAAGCAAATGGCAAAGTGGCGAAACGTCTGTCATTCCGGAGGCGCTCACATTTAATTGCAGATTCCTTC
AACAAGATGCCTGCGTACAGGTTGTTCAACCCAAGACTCGTTTACGCGGATACGAGCTTTATGTCGTTGAGCAAT
GGGCCTGCTCAAGACAGTCGCCGACTGTTGTCGTTGTGACCTTTACCGGAGACGAGACGCACTTTATATACACTG
GCGTCATCACAGTCCCTCGAGATGAGGGACTCTGGTCTCCGCGCTTGCGCGTCTATCTTACTGCTGCTCACCAGC
ACCATGCTCGAGCCAAACAGACCAATCTAGGAGAAATCGTCGTGACCAATCTGAGCAATTTCCCCTCGGCACTTA
CCGTTATTCCCGTACCGGATGGAGATGTATCAAAACATCGGCAGCTCTTCTTTGTCAATGAAGACTTGAAACGAC
TTGGCTGCTCCGGCCGCTCAGGCCTTATTCTATCTGAGCCTGCCGAGGCCACACAGGCCAAGTTTCAGCAACTCT
ACCGGACCAGCGATCGAATCCCCTTCTGGTCATCAGTCACAGAACTCGTCAAACTGTGCCAAGTCGCCCTTTATT
TGTTCGACAAGCTTGATTATGAATATATAGATGGACTCTTGTGCGACATGACCGAGACTGCCATTGGCAACTGGT
GGACAGAACTTGGTGCCGAGCATTACAACTTTGAACCTTCTGACGGCATCCTAGGTCCTTGTACCGTGGCCGCTT
TGCTAGGCATGCTCATGGGGGCAAGGAATCGACTACATTGGTATGGCGCTCCTGTCTCCAAAGATGTCTTTGACA
TTGAAAGCACCAAACGAGGCATTGGATACTTCCAGAAGCAGCAAAAGCTGGAAAAGAAGCGACGTTTGGACCGTC
AGACATTATTCAGGCTTCACAAGGTTACCGCAAAAGCAGTTGCCGCAGACGGCTGGGGGGTGCAAAAGGCAGTCA
AGTCGACAGTGTCCGAGATTGGTGGGAAAAGAGGAGAAATTGTGCTCGACATGGTTTCCAGGGATAAAGGAGGCA
TTGCGGACATTGAGACACTTGACATTGACACCTTTGTTCATCTCGTCTATGGCGCGCGCCCAAAATGGCTTTGGC
ATGGCAAAGCCAGAAGAAGTACCGCAGAAATACAAGAATTCGAATTTGGTACCGGCAACGCCATGTTGTCAAGAA
ACGAAGCTACTGGTCAGCTAGCAAAACGAAGCCAGTCATTGCCCTTAGATGAAGAACTCGAGGCCAAGAAGGATG
AGACGTTGAGTGCAGTAGCTGGATTCGCCGGCCCCTCTTGTGATAACTCGACGGATCGAGAAGCATCAAAGAAGG
CAGTCTTCAAGAGTGTTGCTGGAAAAATGAGTGATCGGATCAAGGACGCCGTCGGTGGGGGCCGCCGAGGTCAAG
CCGGCCGTCAGTCAACCCCAGCTAGAGAGGAGGAAACGGGAAGCACAGGGCTTGCCCTGAGCAACACATCGCAGG
CTATCTTAGCTTCGAGTCCTGTCGCTGTAGGCCGAGTCTTTACTTGGCGACCCAAGCCAGAAGAAGAACAAGCTG
CCACGAGACGAAGCGATACTGCTGCGTCCCTAACCGTTTTGGAATCATGGCGAGGGGCCGACTTGTCTACCCTGG
ATGACAAGTTGGCATCGCGTTCAACAGACAGGGAAACTGCTCTGGACAATAAATCGGCACAAGCGCACCAGGCGC
CGCCGCCGCAAGCACCGGCACAAGCTGACGACAAGGACGCGAATGGAGAGGGCATGCCGAGCGGCGAGTGCAAGA
TGAATAACCAAAGACCAACTGTGTTCCGACGTCGCAGCTGCGGCGTTTCCGATGTCTCGTGCAAGCATGTCGTCA
ATGAGAATCGGTGGGCCCGTCACATGTCATTTGGAGACGCACAAGCAGCCATCTTGACATGGGAGGAGGTTGTTG
ACTTTGACGACACTACTGGGGGCCTCGAGTCTCTTGACGCTCGCGCCGCAGAAGCTGAGCGCCTGAGCCGGCTTG
TGAATGGAATGGAGCAAGCAATTGGGCCATGGGTCGAGGACAAGGTCAAGACGATTGAAGCGCTGGACGAGCGGT
ATGCACGCGACACTGGCGAGCTGCAGGAGCTCTACCAACAGATGAGTGAGGCATGCAAGAGTGTGCGGCACAGCT
CGGATGAACTTTTGGCTTCACAGCGAGCCACCCTGGCGGAGAGCGTCAAGGAGATTGAGGTACTGGTGGCGCGAC
TCGAATACGAAATGGATAATTTGGCGTCAAAGGTGCGAGACGTGGACGACGGCATTGAAAACTTTGAGCAGCTGG
TTGAGGGCGTCGAGGAACGCGCCGAGGAGCTCAAGACGCAGCTCGAGACGGAGTCTTGGCTGCACTGGCTCGTCA
GGACCATGACGGGCGTGGGAACAGGGCCCAATGTGACGCGAGGAGCCCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail