Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1307
Gene name
LocationContig_131:26457..26979
Strand+
Gene length (bp)522
Transcript length (bp)306
Coding sequence length (bp)306
Protein length (aa) 102

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger 1.1E-18 17 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPZ1|TIM10_GIBZE Mitochondrial import inner membrane translocase subunit TIM10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM10 PE=3 SV=1 1 78 2.0E-43
sp|Q4WJX5|TIM10_ASPFU Mitochondrial import inner membrane translocase subunit tim10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim10 PE=3 SV=1 3 90 1.0E-26
sp|Q9C0N3|TIM10_NEUCR Mitochondrial import inner membrane translocase subunit tim10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim10 PE=1 SV=1 3 87 8.0E-26
sp|Q9Y8A8|TIM10_EMENI Mitochondrial import inner membrane translocase subunit tim10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim10 PE=3 SV=1 3 78 3.0E-25
sp|P87108|TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM10 PE=1 SV=1 1 88 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IPZ1|TIM10_GIBZE Mitochondrial import inner membrane translocase subunit TIM10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM10 PE=3 SV=1 1 78 2.0E-43
sp|Q4WJX5|TIM10_ASPFU Mitochondrial import inner membrane translocase subunit tim10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim10 PE=3 SV=1 3 90 1.0E-26
sp|Q9C0N3|TIM10_NEUCR Mitochondrial import inner membrane translocase subunit tim10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim10 PE=1 SV=1 3 87 8.0E-26
sp|Q9Y8A8|TIM10_EMENI Mitochondrial import inner membrane translocase subunit tim10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim10 PE=3 SV=1 3 78 3.0E-25
sp|P87108|TIM10_YEAST Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM10 PE=1 SV=1 1 88 1.0E-24
sp|Q759W7|TIM10_ASHGO Mitochondrial import inner membrane translocase subunit TIM10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM10 PE=3 SV=1 3 86 2.0E-23
sp|Q6CIK7|TIM10_KLULA Mitochondrial import inner membrane translocase subunit TIM10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM10 PE=3 SV=1 3 86 9.0E-23
sp|Q6C6U1|TIM10_YARLI Mitochondrial import inner membrane translocase subunit TIM10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM10 PE=3 SV=1 1 93 3.0E-22
sp|Q9UTE9|TIM10_SCHPO Mitochondrial import inner membrane translocase subunit tim10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim10 PE=3 SV=1 1 83 5.0E-21
sp|Q6DI06|TIM10_DANRE Mitochondrial import inner membrane translocase subunit Tim10 OS=Danio rerio GN=timm10 PE=3 SV=1 18 93 8.0E-20
sp|Q2NKR1|TIM10_BOVIN Mitochondrial import inner membrane translocase subunit Tim10 OS=Bos taurus GN=TIMM10 PE=3 SV=1 18 93 1.0E-18
sp|P62074|TIM10_RAT Mitochondrial import inner membrane translocase subunit Tim10 OS=Rattus norvegicus GN=Timm10 PE=3 SV=1 18 75 2.0E-18
sp|P62073|TIM10_MOUSE Mitochondrial import inner membrane translocase subunit Tim10 OS=Mus musculus GN=Timm10 PE=1 SV=1 18 75 2.0E-18
sp|P62072|TIM10_HUMAN Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens GN=TIMM10 PE=1 SV=1 18 75 2.0E-18
sp|Q6P321|TIM10_XENTR Mitochondrial import inner membrane translocase subunit Tim10 OS=Xenopus tropicalis GN=timm10 PE=3 SV=1 18 75 2.0E-18
sp|Q6GQ52|TI10B_XENLA Mitochondrial import inner membrane translocase subunit Tim10-B OS=Xenopus laevis GN=timm10-b PE=3 SV=1 18 75 3.0E-18
sp|Q6BHJ3|TIM10_DEBHA Mitochondrial import inner membrane translocase subunit TIM10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM10 PE=3 SV=1 3 84 1.0E-17
sp|Q9P335|TIM10_PICSO Mitochondrial import inner membrane translocase subunit Tim10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=TIM10 PE=3 SV=1 3 84 2.0E-17
sp|Q9Y0V6|TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans GN=tin-10 PE=3 SV=1 11 83 2.0E-17
sp|Q9W2D6|TIM10_DROME Mitochondrial import inner membrane translocase subunit Tim10 OS=Drosophila melanogaster GN=Tim10 PE=3 SV=1 21 76 6.0E-17
sp|Q61BP6|TIM10_CAEBR Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis briggsae GN=tin-10 PE=3 SV=1 11 83 1.0E-16
sp|Q4QR62|TI10A_XENLA Mitochondrial import inner membrane translocase subunit Tim10-A OS=Xenopus laevis GN=timm10-a PE=3 SV=1 11 75 2.0E-16
sp|P0CR98|TIM10_CRYNJ Mitochondrial import inner membrane translocase subunit TIM10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM10 PE=3 SV=1 16 93 3.0E-15
sp|P0CR99|TIM10_CRYNB Mitochondrial import inner membrane translocase subunit TIM10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM10 PE=3 SV=1 16 93 3.0E-15
sp|Q9ZW33|TIM10_ARATH Mitochondrial import inner membrane translocase subunit TIM10 OS=Arabidopsis thaliana GN=TIM10 PE=1 SV=1 12 78 7.0E-11
sp|P32830|TIM12_YEAST Mitochondrial import inner membrane translocase subunit TIM12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM12 PE=1 SV=1 1 82 4.0E-08
sp|Q54NZ0|TIM10_DICDI Mitochondrial import inner membrane translocase subunit Tim10 OS=Dictyostelium discoideum GN=timm10 PE=3 SV=1 14 98 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1307
MSLFGMGRQQPTSEQKIMAVEGEMRMMADTYNRLQKTCQKKCVPTDYREGELNKGEAVCLDRCTVKFLDASMKIG
EIMQQQGQAMSGASGAPGASGGLFGS*
Coding >OphauB2|1307
ATGTCCCTCTTCGGCATGGGACGGCAGCAGCCGACCTCTGAGCAAAAAATCATGGCCGTCGAGGGCGAGATGCGC
ATGATGGCCGACACGTACAACCGACTGCAAAAGACGTGCCAAAAAAAGTGCGTGCCCACCGACTACCGCGAGGGA
GAACTCAACAAGGGCGAGGCCGTCTGTCTGGACCGCTGCACAGTCAAGTTTCTCGACGCCTCCATGAAGATTGGC
GAGATTATGCAGCAGCAGGGACAGGCCATGAGCGGTGCCAGTGGTGCACCTGGAGCTAGTGGCGGCTTGTTTGGG
TCTTGA
Transcript >OphauB2|1307
ATGTCCCTCTTCGGCATGGGACGGCAGCAGCCGACCTCTGAGCAAAAAATCATGGCCGTCGAGGGCGAGATGCGC
ATGATGGCCGACACGTACAACCGACTGCAAAAGACGTGCCAAAAAAAGTGCGTGCCCACCGACTACCGCGAGGGA
GAACTCAACAAGGGCGAGGCCGTCTGTCTGGACCGCTGCACAGTCAAGTTTCTCGACGCCTCCATGAAGATTGGC
GAGATTATGCAGCAGCAGGGACAGGCCATGAGCGGTGCCAGTGGTGCACCTGGAGCTAGTGGCGGCTTGTTTGGG
TCTTGA
Gene >OphauB2|1307
ATGTCCCTCTTCGGCATGGGACGGCAGCAGCCGACCTCTGAGCAAAAAATCATGGCCGTCGAGGGCGAGATGCGC
ATGATGGCCGACACGTACAACCGGTACGCCAAAGAGCTCAATCTCCCTTGTCTCCCAGTTTCCTGCAGCCCGGCC
ACGCCGTCGATTCTCCACGAGATTGCCTGTGCACTCCAATAAAGAAGATCAAGGGGGCAAAGAACAGGACCAAAG
ACTCAGGAGAAGATGCACTTTTCACCCTCTCAACAAGACTAGGCGGGACCAGACCTTGAACCACGAGCTTGCTGA
CCAAGGGAGTGCAGACTGCAAAAGACGTGCCAAAAAAAGTGCGTGCCCACCGACTACCGCGAGGGAGAACTCAAC
AAGGGCGAGGCCGTCTGTCTGGACCGCTGCACAGTCAAGTTTCTCGACGCCTCCATGAAGATTGGCGAGATTATG
CAGCAGCAGGGACAGGCCATGAGCGGTGCCAGTGGTGCACCTGGAGCTAGTGGCGGCTTGTTTGGGTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail