Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1304
Gene name
LocationContig_131:20837..23247
Strand-
Gene length (bp)2410
Transcript length (bp)2271
Coding sequence length (bp)2271
Protein length (aa) 757

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 7.0E-07 221 363

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P08638|LEUR_YEAST Regulatory protein LEU3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU3 PE=1 SV=1 42 645 2.0E-38
sp|Q59UY7|SEF1_CANAL Transcriptional regulatory protein SEF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEF1 PE=1 SV=1 16 664 9.0E-18
sp|Q74Z37|SEF1_ASHGO Putative transcription factor SEF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEF1 PE=3 SV=1 205 549 1.0E-15
sp|P87164|SEF1_KLULA Putative transcription factor SEF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEF1 PE=3 SV=3 205 460 5.0E-14
sp|P34228|SEF1_YEAST Putative transcription factor SEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEF1 PE=1 SV=4 205 655 7.0E-12

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding No
GO:0044249 cellular biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016070 RNA metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005488 binding No
GO:0018130 heterocycle biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0097659 nucleic acid-templated transcription No
GO:1901360 organic cyclic compound metabolic process No
GO:0044424 intracellular part No
GO:0044464 cell part No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009058 biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0043169 cation binding No
GO:1901576 organic substance biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0043229 intracellular organelle No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0043226 organelle No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1304
MDGSSIVARGASSVSPTSPTSSRHGNGAPKRKRSTGMPGPESSPGSIMDEDHGDHGDHDRKRQPGVKRACNECRQ
QKVVYKSPLPLRCDVVQDPFQSCSRCNRLKLECKIESNFKRIGKRSKHAEMEREIERLRRKVARAKSQGFLSQDD
EHADGSTLSTHGNASSSLEHVSHGSMMGSDEAVSSLLNLKTGGNFAMQPQYSHQLENVRLNDSQVAHLFNEFFYR
YHPFLPFLNPEQPPEIYKQQHPLLFWSMIAVAARRFTRSSDCRNLLDQLSGPLTRYLWTTIGEVPSNYHVVKALC
LLCTWPLPTSTTTSDPTHILCGVMMKTATGVGLHRPNHIRDFSRVSVDLDADQLRDRITTWAVCNIVAQTIGTGY
GQPASTLYDWTLAMKPSDSEQRSSMHLSAELEARLQIERFCDKVSKEMYSNASDPRGVAGDEHRAILLRVFRRDY
GELHASIMSQTWPNCVVSLHLRAAGLHMRLAGLFDSSKTPGYLDDLMGLWRAATSFLDEFLQVGRTTFPRDGMSG
SLLPYATNYLQQMLVAAAFTLLKLMKSFLYNTIDFERGRSLFHHAIRAIRATSVVNNDLQWRLAELMVQMWNGAR
LEHRNRSIKSEEDAPIQIDDSLQLKVRCRHSMSLVFDSVWRWREEFQAQGRGSLENTKHPTNPDSANDSSAASSQ
MDSSLMAPDVPSAANSMVNMNGALTSTNNAAIAPTASAPNSMIGASMAYGDANYELFDPQNWMLDGLIDFNYNMI
TPLEGT*
Coding >OphauB2|1304
ATGGACGGCTCCTCTATTGTCGCCCGTGGGGCCTCGTCGGTCAGCCCGACCAGTCCAACCAGCTCTCGCCATGGA
AACGGCGCCCCAAAACGCAAGAGGAGCACTGGCATGCCTGGCCCTGAGAGCAGCCCTGGCAGCATCATGGATGAG
GATCATGGCGACCACGGCGACCACGATCGCAAGCGCCAGCCCGGAGTCAAGCGCGCTTGCAACGAATGCCGCCAG
CAAAAGGTTGTTTACAAGTCGCCTCTGCCATTGCGCTGCGATGTCGTCCAAGATCCCTTTCAGAGCTGCTCCCGC
TGCAACCGGCTCAAACTCGAGTGCAAAATCGAGTCCAATTTCAAGCGCATAGGAAAGCGGTCCAAGCACGCCGAG
ATGGAACGCGAGATTGAGAGGCTGCGTCGCAAGGTAGCCCGCGCCAAGTCGCAGGGCTTCCTATCCCAAGACGAC
GAACACGCCGATGGCTCTACTCTCTCCACCCATGGCAATGCGTCGTCGAGCCTCGAGCACGTCAGCCATGGCTCC
ATGATGGGCTCGGATGAAGCTGTATCCTCACTGCTCAACCTGAAGACGGGTGGCAACTTTGCCATGCAGCCGCAG
TATTCACATCAACTCGAAAATGTGCGCCTAAACGACTCTCAAGTCGCCCACCTGTTCAACGAGTTCTTCTATAGA
TACCATCCCTTTCTCCCTTTTCTCAATCCCGAACAGCCGCCAGAAATATACAAGCAGCAACATCCCTTGCTCTTC
TGGTCCATGATTGCAGTCGCCGCCCGTCGCTTCACCCGCTCCTCGGACTGCCGCAATCTGCTCGACCAATTGTCA
GGCCCCCTGACGCGCTACCTGTGGACCACGATTGGCGAGGTGCCCAGCAACTACCATGTCGTCAAGGCCTTGTGT
CTTCTCTGCACCTGGCCGCTGCCCACGAGCACCACCACGTCGGACCCAACACACATTCTCTGCGGCGTCATGATG
AAGACGGCTACGGGCGTCGGCCTGCATCGCCCAAACCACATACGCGACTTTTCGCGCGTCTCGGTTGATCTCGAC
GCCGACCAGCTGCGCGATCGCATCACCACCTGGGCCGTTTGCAACATTGTGGCCCAAACCATTGGCACCGGCTAC
GGCCAGCCAGCGTCGACTCTATACGACTGGACCTTGGCCATGAAGCCGTCCGACTCGGAACAGCGCTCCTCGATG
CATCTTTCCGCCGAGTTGGAGGCACGCCTGCAGATTGAGCGCTTCTGCGACAAGGTCTCCAAGGAAATGTACAGC
AACGCCAGCGATCCACGCGGTGTCGCGGGCGACGAACACCGCGCCATTCTCCTCCGGGTCTTTCGGCGAGACTAC
GGCGAGCTGCACGCCTCCATCATGTCTCAGACATGGCCCAATTGCGTTGTGAGCTTGCATCTGCGCGCCGCTGGC
CTTCACATGCGTCTGGCCGGCCTCTTTGATTCTAGCAAGACGCCGGGATACTTGGACGACCTCATGGGCCTCTGG
CGGGCTGCCACCAGCTTCCTCGATGAGTTCCTCCAAGTTGGCAGGACAACCTTTCCCAGAGATGGCATGAGCGGC
AGCCTCCTTCCATATGCCACCAATTACCTGCAGCAGATGCTTGTTGCCGCTGCTTTTACTCTGCTTAAACTCATG
AAGTCTTTTCTCTACAACACCATTGACTTTGAGCGGGGACGCAGCCTGTTCCACCACGCCATTCGCGCCATTCGC
GCCACGAGTGTCGTAAACAATGATTTGCAGTGGCGACTGGCCGAACTCATGGTACAGATGTGGAATGGAGCCAGA
CTGGAGCATCGCAATCGTAGCATCAAATCTGAGGAGGATGCGCCTATACAGATTGACGACAGCCTACAGCTCAAG
GTTCGCTGTCGCCACAGCATGAGCCTCGTTTTTGACTCGGTGTGGCGCTGGCGGGAAGAATTTCAGGCCCAAGGA
AGGGGCTCTCTTGAGAACACGAAGCACCCCACCAATCCCGACTCAGCTAATGACTCTTCGGCAGCCTCGTCTCAA
ATGGACAGTTCTCTCATGGCGCCTGACGTGCCTTCTGCTGCCAACAGCATGGTCAACATGAACGGCGCCCTCACC
TCGACAAATAATGCTGCAATTGCACCCACAGCTTCTGCGCCAAACAGCATGATTGGTGCTTCCATGGCCTATGGC
GACGCCAATTACGAGCTGTTTGATCCTCAGAACTGGATGCTCGACGGGCTCATTGACTTCAACTACAACATGATT
ACTCCATTGGAAGGGACATAA
Transcript >OphauB2|1304
ATGGACGGCTCCTCTATTGTCGCCCGTGGGGCCTCGTCGGTCAGCCCGACCAGTCCAACCAGCTCTCGCCATGGA
AACGGCGCCCCAAAACGCAAGAGGAGCACTGGCATGCCTGGCCCTGAGAGCAGCCCTGGCAGCATCATGGATGAG
GATCATGGCGACCACGGCGACCACGATCGCAAGCGCCAGCCCGGAGTCAAGCGCGCTTGCAACGAATGCCGCCAG
CAAAAGGTTGTTTACAAGTCGCCTCTGCCATTGCGCTGCGATGTCGTCCAAGATCCCTTTCAGAGCTGCTCCCGC
TGCAACCGGCTCAAACTCGAGTGCAAAATCGAGTCCAATTTCAAGCGCATAGGAAAGCGGTCCAAGCACGCCGAG
ATGGAACGCGAGATTGAGAGGCTGCGTCGCAAGGTAGCCCGCGCCAAGTCGCAGGGCTTCCTATCCCAAGACGAC
GAACACGCCGATGGCTCTACTCTCTCCACCCATGGCAATGCGTCGTCGAGCCTCGAGCACGTCAGCCATGGCTCC
ATGATGGGCTCGGATGAAGCTGTATCCTCACTGCTCAACCTGAAGACGGGTGGCAACTTTGCCATGCAGCCGCAG
TATTCACATCAACTCGAAAATGTGCGCCTAAACGACTCTCAAGTCGCCCACCTGTTCAACGAGTTCTTCTATAGA
TACCATCCCTTTCTCCCTTTTCTCAATCCCGAACAGCCGCCAGAAATATACAAGCAGCAACATCCCTTGCTCTTC
TGGTCCATGATTGCAGTCGCCGCCCGTCGCTTCACCCGCTCCTCGGACTGCCGCAATCTGCTCGACCAATTGTCA
GGCCCCCTGACGCGCTACCTGTGGACCACGATTGGCGAGGTGCCCAGCAACTACCATGTCGTCAAGGCCTTGTGT
CTTCTCTGCACCTGGCCGCTGCCCACGAGCACCACCACGTCGGACCCAACACACATTCTCTGCGGCGTCATGATG
AAGACGGCTACGGGCGTCGGCCTGCATCGCCCAAACCACATACGCGACTTTTCGCGCGTCTCGGTTGATCTCGAC
GCCGACCAGCTGCGCGATCGCATCACCACCTGGGCCGTTTGCAACATTGTGGCCCAAACCATTGGCACCGGCTAC
GGCCAGCCAGCGTCGACTCTATACGACTGGACCTTGGCCATGAAGCCGTCCGACTCGGAACAGCGCTCCTCGATG
CATCTTTCCGCCGAGTTGGAGGCACGCCTGCAGATTGAGCGCTTCTGCGACAAGGTCTCCAAGGAAATGTACAGC
AACGCCAGCGATCCACGCGGTGTCGCGGGCGACGAACACCGCGCCATTCTCCTCCGGGTCTTTCGGCGAGACTAC
GGCGAGCTGCACGCCTCCATCATGTCTCAGACATGGCCCAATTGCGTTGTGAGCTTGCATCTGCGCGCCGCTGGC
CTTCACATGCGTCTGGCCGGCCTCTTTGATTCTAGCAAGACGCCGGGATACTTGGACGACCTCATGGGCCTCTGG
CGGGCTGCCACCAGCTTCCTCGATGAGTTCCTCCAAGTTGGCAGGACAACCTTTCCCAGAGATGGCATGAGCGGC
AGCCTCCTTCCATATGCCACCAATTACCTGCAGCAGATGCTTGTTGCCGCTGCTTTTACTCTGCTTAAACTCATG
AAGTCTTTTCTCTACAACACCATTGACTTTGAGCGGGGACGCAGCCTGTTCCACCACGCCATTCGCGCCATTCGC
GCCACGAGTGTCGTAAACAATGATTTGCAGTGGCGACTGGCCGAACTCATGGTACAGATGTGGAATGGAGCCAGA
CTGGAGCATCGCAATCGTAGCATCAAATCTGAGGAGGATGCGCCTATACAGATTGACGACAGCCTACAGCTCAAG
GTTCGCTGTCGCCACAGCATGAGCCTCGTTTTTGACTCGGTGTGGCGCTGGCGGGAAGAATTTCAGGCCCAAGGA
AGGGGCTCTCTTGAGAACACGAAGCACCCCACCAATCCCGACTCAGCTAATGACTCTTCGGCAGCCTCGTCTCAA
ATGGACAGTTCTCTCATGGCGCCTGACGTGCCTTCTGCTGCCAACAGCATGGTCAACATGAACGGCGCCCTCACC
TCGACAAATAATGCTGCAATTGCACCCACAGCTTCTGCGCCAAACAGCATGATTGGTGCTTCCATGGCCTATGGC
GACGCCAATTACGAGCTGTTTGATCCTCAGAACTGGATGCTCGACGGGCTCATTGACTTCAACTACAACATGATT
ACTCCATTGGAAGGGACATAA
Gene >OphauB2|1304
ATGGACGGCTCCTCTATTGTCGCCCGTGGGGCCTCGTCGGTCAGCCCGACCAGTCCAACCAGCTCTCGCCATGGA
AACGGCGCCCCAAAACGCAAGAGGAGCACTGGCATGCCTGGCCCTGAGAGCAGCCCTGGCAGCATCATGGATGAG
GATCATGGCGACCACGGCGACCACGATCGCAAGCGCCAGCCCGGAGTCAAGCGCGCTTGCAACGAATGCCGCCAG
CAAAAGGTTGTTTACAAGTCGCCTCTGCCAGTCCTTTCTTTTTTAGACTTTGGCCTCGGGCTTGCTCCTCTCTGC
CCTGTCGCCTCGGCTGACCAATGCTCCTACAGTTGCGCTGCGATGTCGTCCAAGATCCCTTTCAGAGCTGCTCCC
GCTGCAACCGGCTCAAACTCGAGTGCAAAATCGAGTCCAATTTCAAGCGCATAGGAAAGCGGTCCAAGCACGCCG
AGATGGAACGCGAGATTGAGAGGCTGCGTCGCAAGGTAGCCCGCGCCAAGTCGCAGGGCTTCCTATCCCAAGACG
ACGAACACGCCGATGGCTCTACTCTCTCCACCCATGGCAATGCGTCGTCGAGCCTCGAGCACGTCAGCCATGGCT
CCATGATGGGCTCGGATGAAGCTGTATCCTCACTGCTCAACCTGAAGACGGGTGGCAACTTTGCCATGCAGCCGC
AGTATTCACATCAACTCGAAAATGTGCGCCTAAACGACTCTCAAGTCGCCCACCTGTTCAACGAGTTCTTCTATA
GATACCATCCCTTTCTCCCTTTTCTCAATCCCGAACAGCCGCCAGAAATATACAAGCAGCAACATCCCTTGCTCT
TCTGGTCCATGATTGCAGTCGCCGCCCGTCGCTTCACCCGCTCCTCGGACTGCCGCAATCTGCTCGACCAATTGT
CAGGCCCCCTGACGCGCTACCTGTGGACCACGATTGGCGAGGTGCCCAGCAACTACCATGTCGTCAAGGCCTTGT
GTCTTCTCTGCACCTGGCCGCTGCCCACGAGCACCACCACGTCGGACCCAACACACATTCTCTGCGGCGTCATGA
TGAAGACGGCTACGGGCGTCGGCCTGCATCGCCCAAACCACATACGCGACTTTTCGCGCGTCTCGGTTGATCTCG
ACGCCGACCAGCTGCGCGATCGCATCACCACCTGGGCCGTTTGCAACATTGTGGCCCAAACCATTGGCACCGGCT
ACGGCCAGCCAGCGTCGACTCTATACGACTGGACCTTGGCCATGAAGCCGTCCGACTCGGAACAGCGCTCCTCGA
TGCATCTTTCCGCCGAGTTGGAGGCACGCCTGCAGATTGAGCGCTTCTGCGACAAGGTCTCCAAGGAAATGTACA
GCAACGCCAGCGATCCACGCGGTGTCGCGGGCGACGAACACCGCGCCATTCTCCTCCGGGTCTTTCGGCGAGACT
ACGGCGAGCTGCACGCCTCCATCATGTCTCAGACATGGCCCAATTGCGTTGTGAGCTTGCATCTGCGCGCCGCTG
GCCTTCACATGCGTCTGGCCGGCCTCTTTGATTCTAGCAAGACGCCGGGATACTTGGACGACCTCATGGGCCTCT
GGCGGGCTGCCACCAGCTTCCTCGATGAGTTCCTCCAAGTTGGCAGGACAACCTTTCCCAGAGATGGCATGAGCG
GCAGCCTCCTTCCATATGCCACCAATTACCTGCAGCAGATGCTTGTTGCCGCTGCTTTTACTCTGCTTAAACTCA
TGAAGTCTTTTCTCTACAACACCATTGACTTTGAGCGGGGACGCAGCCTGTTCCACCACGCCATTCGCGCCATTC
GCGCCACGAGTGTCGTAAACAATGATTTGCAGTGGCGACTGGCCGAACTCATGGTACAGATGTGGAATGGAGCCA
GACTGGAGCATCGCAATCGTAGCATCAAATCTGAGGAGGATGCGCCTATACAGATTGACGACAGCCTACAGCTCA
AGGTTCGCTGTCGCCACAGCATGAGCCTCGTTTTTGACTCGGTGTGGCGCTGGCGGGAAGAATTTCAGGCCCAAG
GAAGGGGCTCTCTTGAGAGTGAGTACAGCCTCTGGCTTGGCTTTGGCCAGCACAAGGCGGCTGATGGCATCATGA
CACAGACACGAAGCACCCCACCAATCCCGACTCAGCTAATGACTCTTCGGCAGCCTCGTCTCAAATGGACAGTTC
TCTCATGGCGCCTGACGTGCCTTCTGCTGCCAACAGCATGGTCAACATGAACGGCGCCCTCACCTCGACAAATAA
TGCTGCAATTGCACCCACAGCTTCTGCGCCAAACAGCATGATTGGTGCTTCCATGGCCTATGGCGACGCCAATTA
CGAGCTGTTTGATCCTCAGAACTGGATGCTCGACGGGCTCATTGACTTCAACTACAACATGATTACTCCATTGGA
AGGGACATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail