Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|128
Gene name
LocationContig_1:332346..332984
Strand+
Gene length (bp)638
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 124 143 19
2 158 180 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6312
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3627
Ophiocordyceps australis map64 (Brazil) OphauB2|128 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|428
Ophiocordyceps kimflemingae Ophio5|5441
Ophiocordyceps subramaniannii Hirsu2|9317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|128
MLHLMPSPCRKLTRSVSYADVAASGPRQSAKEAAAPPPPEVVSTESASTASLIDVDMPSVHTVSSDFLEQDVKTE
TQAHRREREDAAREAKAAREQAAKDATAKRDTSQSLGERIAALYDSSAGALFLANMVTFVGLSSYFGYKGFGLYQ
QGRLDWKAAGTGLAILAAVGIAPSACDSLLSKKKRNP*
Coding >OphauB2|128
ATGTTGCACTTGATGCCCTCACCTTGTCGCAAGCTAACGCGCTCAGTGTCGTACGCAGACGTTGCCGCCAGCGGA
CCACGCCAATCCGCCAAAGAGGCCGCCGCGCCTCCGCCGCCCGAGGTGGTGTCGACGGAATCCGCATCGACGGCG
TCGTTGATTGACGTGGATATGCCTAGTGTGCACACCGTGTCGTCTGATTTTCTCGAGCAGGATGTCAAGACGGAG
ACGCAGGCTCATCGTCGGGAGCGCGAAGATGCTGCTCGCGAGGCCAAGGCGGCGCGCGAACAGGCTGCAAAGGAC
GCGACCGCAAAGAGGGACACTAGTCAGTCGCTTGGGGAGCGCATTGCTGCTCTCTACGACTCGTCGGCCGGCGCG
CTATTCTTGGCAAACATGGTTACTTTTGTCGGCTTGAGCTCCTACTTTGGCTACAAGGGCTTTGGGCTCTACCAG
CAGGGTAGGCTTGATTGGAAAGCGGCGGGTACGGGGCTGGCTATTCTGGCGGCGGTTGGCATTGCGCCTTCTGCC
TGCGACTCGCTCCTCTCCAAGAAGAAGCGCAATCCGTGA
Transcript >OphauB2|128
ATGTTGCACTTGATGCCCTCACCTTGTCGCAAGCTAACGCGCTCAGTGTCGTACGCAGACGTTGCCGCCAGCGGA
CCACGCCAATCCGCCAAAGAGGCCGCCGCGCCTCCGCCGCCCGAGGTGGTGTCGACGGAATCCGCATCGACGGCG
TCGTTGATTGACGTGGATATGCCTAGTGTGCACACCGTGTCGTCTGATTTTCTCGAGCAGGATGTCAAGACGGAG
ACGCAGGCTCATCGTCGGGAGCGCGAAGATGCTGCTCGCGAGGCCAAGGCGGCGCGCGAACAGGCTGCAAAGGAC
GCGACCGCAAAGAGGGACACTAGTCAGTCGCTTGGGGAGCGCATTGCTGCTCTCTACGACTCGTCGGCCGGCGCG
CTATTCTTGGCAAACATGGTTACTTTTGTCGGCTTGAGCTCCTACTTTGGCTACAAGGGCTTTGGGCTCTACCAG
CAGGGTAGGCTTGATTGGAAAGCGGCGGGTACGGGGCTGGCTATTCTGGCGGCGGTTGGCATTGCGCCTTCTGCC
TGCGACTCGCTCCTCTCCAAGAAGAAGCGCAATCCGTGA
Gene >OphauB2|128
ATGTTGCACTTGATGCCCTCACCTTGTCGCAAGCTAACGCGCTCAGTGTCGTACGCAGACGTTGCCGCCAGCGGA
CCACGCCAATCCGCCAAAGAGGTATTCACACACACCCGTCCCCCCCCCTTCCCCTTCTTACCAACTAGTCTCTAA
AAAATAACTCGTCCTCCTAGGCCGCCGCGCCTCCGCCGCCCGAGGTGGTGTCGACGGAATCCGCATCGACGGCGT
CGTTGATTGACGTGGATATGCCTAGTGTGCACACCGTGTCGTCTGATTTTCTCGAGCAGGATGTCAAGACGGAGA
CGCAGGCTCATCGTCGGGAGCGCGAAGATGCTGCTCGCGAGGCCAAGGCGGCGCGCGAACAGGCTGCAAAGGACG
CGACCGCAAAGAGGGACACTAGTCAGTCGCTTGGGGAGCGCATTGCTGCTCTCTACGACTCGTCGGCCGGCGCGC
TATTCTTGGCAAACATGGTTACTTTTGTCGGCTTGAGCTCCTACTTTGGCTACAAGGGCTTTGGGCTCTACCAGC
AGGGTAGGCTTGATTGGAAAGCGGCGGGTACGGGGCTGGCTATTCTGGCGGCGGTTGGCATTGCGCCTTCTGCCT
GCGACTCGCTCCTCTCCAAGAAGAAGCGCAATCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail