Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1276
Gene name
LocationContig_13:266854..270167
Strand+
Gene length (bp)3313
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family 3.6E-43 226 408

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05534|PHOG_EMENI Protein pacG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pacG PE=3 SV=3 226 410 7.0E-09
sp|Q9C2N1|VIB1_NEUCR Transcription factor vib-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vib-1 PE=3 SV=1 208 426 9.0E-09

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1276
MRCVDGACLDYNSSPTQCEDLSLLEIQAQSGDLSRFTQEPHAPSSSLTIVEAPQPSPLLTIFPNGLHAPYTHDTS
GFYQPQGPIQYAAADVRSRLASNSSPSTGMAHAPSHGHRNTQHHLQIGAREQYATTTPSFRRASEHLSRSPPFAT
RRQQLTASQSSLVPPAAGRMEAGQYGGRQSQQGGAPPLQEVQTLGSLQYVDQSMTPIKVDITGKMEKGPFLSRDQ
EWTCYRRNYLACVCSYSLHPLHYPNVPIQFVPASSGSTVQVYGFAMCISAVVAENEQQNIELVQHTPKRDKGPIN
KPSKVPLAPKTGQACHHYADAASRPYADAQQPAPSNGQLPSEHMFERIQFKHATLNNGKRRAAQQYYHLVVELWA
DVGTQLPDQFVKVAYRKSAKMIVRGRSPGHYQNERRESHGDGPGGSAGSMGGYGHIGSMADFGSSQMLPTGPYAS
TPYSSSSATNDSRGAANVYRQPHDLTPADDAAALVTPDDASKMGLDASSKTYQHHYYYDAQHDRPDVYHHRPDGI
LPSIAADAKVKSEYEFGGMLPRPYGITNTAVSTPRMLDTHHQHQPLHHQHHHPLLHHHSVHHPDHHQPRHQAHQR
QQPDQFADGKTTSAAYYPSIVSPTGTGIHMTMA*
Coding >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGACTACAATTCCTCGCCGACGCAGTGCGAGGATCTGAGTCTCCTGGAG
ATCCAGGCTCAGTCGGGTGATTTGAGCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTA
GAAGCCCCCCAGCCGTCGCCGCTGCTGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGC
GGCTTCTACCAGCCTCAGGGCCCAATCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAATTCGAGT
CCGTCGACGGGCATGGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGC
GAGCAGTACGCAACGACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACG
CGGCGCCAGCAGCTAACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTAC
GGCGGGCGGCAGAGCCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTG
GACCAGAGCATGACGCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAG
GAGTGGACGTGCTACCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAAC
GTGCCCATACAGTTTGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCC
GTGGTGGCGGAGAATGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAAC
AAGCCCTCCAAGGTGCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCC
TATGCCGATGCCCAGCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTC
AAGCACGCCACGCTCAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCC
GACGTGGGCACCCAGCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGC
CGCTCCCCCGGCCACTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATG
GGCGGCTACGGCCACATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCG
ACGCCCTACAGCAGCAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTG
ACGCCCGCCGACGATGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAG
ACGTACCAGCACCACTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATC
CTGCCCAGCATTGCCGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGC
ATCACCAACACGGCTGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACAC
CACCATCCCCTGCTGCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGC
CAGCAGCCCGACCAGTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGC
ACCGGAATCCACATGACCATGGCATGA
Transcript >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGACTACAATTCCTCGCCGACGCAGTGCGAGGATCTGAGTCTCCTGGAG
ATCCAGGCTCAGTCGGGTGATTTGAGCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTA
GAAGCCCCCCAGCCGTCGCCGCTGCTGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGC
GGCTTCTACCAGCCTCAGGGCCCAATCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAATTCGAGT
CCGTCGACGGGCATGGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGC
GAGCAGTACGCAACGACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACG
CGGCGCCAGCAGCTAACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTAC
GGCGGGCGGCAGAGCCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTG
GACCAGAGCATGACGCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAG
GAGTGGACGTGCTACCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAAC
GTGCCCATACAGTTTGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCC
GTGGTGGCGGAGAATGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAAC
AAGCCCTCCAAGGTGCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCC
TATGCCGATGCCCAGCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTC
AAGCACGCCACGCTCAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCC
GACGTGGGCACCCAGCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGC
CGCTCCCCCGGCCACTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATG
GGCGGCTACGGCCACATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCG
ACGCCCTACAGCAGCAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTG
ACGCCCGCCGACGATGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAG
ACGTACCAGCACCACTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATC
CTGCCCAGCATTGCCGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGC
ATCACCAACACGGCTGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACAC
CACCATCCCCTGCTGCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGC
CAGCAGCCCGACCAGTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGC
ACCGGAATCCACATGACCATGGCATGA
Gene >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGTACGTATGTAACGTGAATGTCTGAGCAAGCAACAGACCATGATTTTC
TTTTTAGTCTTGTTTTTCTTTTCCTCGCTCTCTCGTCTTGCCGAGGCCAAGGATGGAGTGGGTTGCGTGGACGGT
TGAGGGCATCTGGCCCCATGTGTCTGGGCCGTTGTCGTACGTCATGCAGTTTGGAGCTTGGGCTGCCCTTTTTTC
TTACGCATTGCACGCTGCGAGGGACGAAAAAGAAGACGTGGTCTTTGCGCAGCAGAAGGGTCGGTCTGGAGCCGA
AAAAAAAAAATCGATGCAGACCCCGGGCGTGTCTTGTGTAACCACAAGCCCCGTCATGGGTGGCGTCGAGGTGGT
TCCGACCGGTGCGGTGCCAGGTACTATTCCTGGGGCAGCGAGTACTCTGTTGTACTGGGCTGTACAGATGAGAGT
ACCGTTTGCATCCCGGGTCGAGTTGCATTATCACCCAAGAGACAGTGTCATCCCGAGCACGACGACGCACATCCC
TTCCTCCCCCGGGCCATGTCTTGCTGCAAGCTAACTGATGGGAAGCCCAGGTTTATAATGCTGAGCGCTAGCCGT
ATTCCTTTTTTTTTTTTTTTGGTTTTATTAAAAGAAGGATTAGTTGCACGCCATGGCGAGAGGAGGCTGTGGTGC
TCAAGGTTTACAAGGCGGCAGTATGCGATTCTAACATGGTTGTGGCTCGACGCAGGACTACAATTCCTCGCCGAC
GCAGTGCGAGGATCTGAGTCTCCTGGAGATCCAGGCTCAGTCGGGTGATTTGAGGTGAGTCTTGGCAGTTGTTTT
GGTCTTGGTGCGTGCTGGGGCCTTTTTAGTCTCTGTTTGAACAAGTGTTTATATATTTCTGCCATGGTTGCCAGT
GTTGAAGCAGCGGACTAGGTGGACAAGAGGCGTGCATCACGTCTGAAGCGGGTCGGTCAAGAGGGTTCAGTTGGC
CCCGCTGGGTTGCTGGATGGAGGCGTGGGATCAAGATGGTGATTGATGGCGACTCGTGGAGTCGGTTCGGCAGAC
AGGTGTACGACGTGAGCGCTGGCAGTATCACATCACGCCGCAGCCGGGTGGCACAAGGTTGCCGTCTATGGCATG
GAGGCGGAAGGCGGCACAGCATGATAATGGTTGAGCCTTGTTTTGACGGCTTTTTATACTGATGCAGGGATGGCA
GCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTAGAAGCCCCCCAGCCGTCGCCGCTGC
TGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGCGGCTTCTACCAGCCTCAGGGCCCAA
TCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAAGTGAGTTGGCTGTTGTGCGTCTGCTGCCCTGT
CCTGTCTGTCTGCTGCCCTGGCCGTCTGGAGCCTTTTTGGGCCTACTCCCTCTGCCATTGCCTTCACCCGCCCTG
CACTCCCCCCCCCCCTCTCCCCCTCTGCCATTGCACTCACGCCCCCCGTGCACTGCTGCTTTGCGCCACCCCTCC
CTCGGCGTAGACAAGCAGTCTTTTGTCTCTCCTTGCTGTGCTGGTGGTGGATACATGGCTACTACATAGACATGG
CCACATACATGATGCACTGGACAAAGCAGTGCTCAGGAGCTCACCAGTGCGCAGTTCGAGTCCGTCGACGGGCAT
GGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGCGAGCAGTACGCAAC
GACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACGCGGCGCCAGCAGCT
AACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTACGGCGGGCGGCAGAG
CCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTGGACCAGAGCATGAC
GCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAGGAGTGGACGTGCTA
CCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAACGTGCCCATACAGTT
TGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCCGTGGTGGCGGAGAA
TGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAACAAGCCCTCCAAGGT
GCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCCTATGCCGATGCCCA
GCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTCAAGCACGCCACGCT
CAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCCGACGTGGGCACCCA
GCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGCCGCTCCCCCGGCCA
CTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATGGGCGGCTACGGCCA
CATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCGACGCCCTACAGCAG
CAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTGACGCCCGCCGACGA
TGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAGACGTACCAGCACCA
CTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATCCTGCCCAGCATTGC
CGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGCATCACCAACACGGC
TGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACACCACCATCCCCTGCT
GCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGCCAGCAGCCCGACCA
GTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGCACCGGAATCCACAT
GACCATGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail