Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1276
Gene name
LocationContig_13:266854..270167
Strand+
Gene length (bp)3313
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family 3.6E-43 226 408

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05534|PHOG_EMENI Protein pacG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pacG PE=3 SV=3 226 410 7.0E-09
sp|Q9C2N1|VIB1_NEUCR Transcription factor vib-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vib-1 PE=3 SV=1 208 426 9.0E-09

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5819
Ophiocordyceps australis map64 (Brazil) OphauB2|1276 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04064
Ophiocordyceps camponoti-rufipedis Ophun1|1089
Ophiocordyceps kimflemingae Ophio5|201
Ophiocordyceps subramaniannii Hirsu2|5413

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1276
MRCVDGACLDYNSSPTQCEDLSLLEIQAQSGDLSRFTQEPHAPSSSLTIVEAPQPSPLLTIFPNGLHAPYTHDTS
GFYQPQGPIQYAAADVRSRLASNSSPSTGMAHAPSHGHRNTQHHLQIGAREQYATTTPSFRRASEHLSRSPPFAT
RRQQLTASQSSLVPPAAGRMEAGQYGGRQSQQGGAPPLQEVQTLGSLQYVDQSMTPIKVDITGKMEKGPFLSRDQ
EWTCYRRNYLACVCSYSLHPLHYPNVPIQFVPASSGSTVQVYGFAMCISAVVAENEQQNIELVQHTPKRDKGPIN
KPSKVPLAPKTGQACHHYADAASRPYADAQQPAPSNGQLPSEHMFERIQFKHATLNNGKRRAAQQYYHLVVELWA
DVGTQLPDQFVKVAYRKSAKMIVRGRSPGHYQNERRESHGDGPGGSAGSMGGYGHIGSMADFGSSQMLPTGPYAS
TPYSSSSATNDSRGAANVYRQPHDLTPADDAAALVTPDDASKMGLDASSKTYQHHYYYDAQHDRPDVYHHRPDGI
LPSIAADAKVKSEYEFGGMLPRPYGITNTAVSTPRMLDTHHQHQPLHHQHHHPLLHHHSVHHPDHHQPRHQAHQR
QQPDQFADGKTTSAAYYPSIVSPTGTGIHMTMA*
Coding >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGACTACAATTCCTCGCCGACGCAGTGCGAGGATCTGAGTCTCCTGGAG
ATCCAGGCTCAGTCGGGTGATTTGAGCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTA
GAAGCCCCCCAGCCGTCGCCGCTGCTGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGC
GGCTTCTACCAGCCTCAGGGCCCAATCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAATTCGAGT
CCGTCGACGGGCATGGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGC
GAGCAGTACGCAACGACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACG
CGGCGCCAGCAGCTAACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTAC
GGCGGGCGGCAGAGCCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTG
GACCAGAGCATGACGCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAG
GAGTGGACGTGCTACCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAAC
GTGCCCATACAGTTTGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCC
GTGGTGGCGGAGAATGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAAC
AAGCCCTCCAAGGTGCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCC
TATGCCGATGCCCAGCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTC
AAGCACGCCACGCTCAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCC
GACGTGGGCACCCAGCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGC
CGCTCCCCCGGCCACTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATG
GGCGGCTACGGCCACATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCG
ACGCCCTACAGCAGCAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTG
ACGCCCGCCGACGATGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAG
ACGTACCAGCACCACTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATC
CTGCCCAGCATTGCCGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGC
ATCACCAACACGGCTGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACAC
CACCATCCCCTGCTGCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGC
CAGCAGCCCGACCAGTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGC
ACCGGAATCCACATGACCATGGCATGA
Transcript >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGACTACAATTCCTCGCCGACGCAGTGCGAGGATCTGAGTCTCCTGGAG
ATCCAGGCTCAGTCGGGTGATTTGAGCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTA
GAAGCCCCCCAGCCGTCGCCGCTGCTGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGC
GGCTTCTACCAGCCTCAGGGCCCAATCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAATTCGAGT
CCGTCGACGGGCATGGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGC
GAGCAGTACGCAACGACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACG
CGGCGCCAGCAGCTAACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTAC
GGCGGGCGGCAGAGCCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTG
GACCAGAGCATGACGCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAG
GAGTGGACGTGCTACCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAAC
GTGCCCATACAGTTTGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCC
GTGGTGGCGGAGAATGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAAC
AAGCCCTCCAAGGTGCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCC
TATGCCGATGCCCAGCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTC
AAGCACGCCACGCTCAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCC
GACGTGGGCACCCAGCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGC
CGCTCCCCCGGCCACTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATG
GGCGGCTACGGCCACATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCG
ACGCCCTACAGCAGCAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTG
ACGCCCGCCGACGATGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAG
ACGTACCAGCACCACTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATC
CTGCCCAGCATTGCCGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGC
ATCACCAACACGGCTGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACAC
CACCATCCCCTGCTGCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGC
CAGCAGCCCGACCAGTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGC
ACCGGAATCCACATGACCATGGCATGA
Gene >OphauB2|1276
ATGAGATGTGTCGACGGCGCCTGTCTGGTACGTATGTAACGTGAATGTCTGAGCAAGCAACAGACCATGATTTTC
TTTTTAGTCTTGTTTTTCTTTTCCTCGCTCTCTCGTCTTGCCGAGGCCAAGGATGGAGTGGGTTGCGTGGACGGT
TGAGGGCATCTGGCCCCATGTGTCTGGGCCGTTGTCGTACGTCATGCAGTTTGGAGCTTGGGCTGCCCTTTTTTC
TTACGCATTGCACGCTGCGAGGGACGAAAAAGAAGACGTGGTCTTTGCGCAGCAGAAGGGTCGGTCTGGAGCCGA
AAAAAAAAAATCGATGCAGACCCCGGGCGTGTCTTGTGTAACCACAAGCCCCGTCATGGGTGGCGTCGAGGTGGT
TCCGACCGGTGCGGTGCCAGGTACTATTCCTGGGGCAGCGAGTACTCTGTTGTACTGGGCTGTACAGATGAGAGT
ACCGTTTGCATCCCGGGTCGAGTTGCATTATCACCCAAGAGACAGTGTCATCCCGAGCACGACGACGCACATCCC
TTCCTCCCCCGGGCCATGTCTTGCTGCAAGCTAACTGATGGGAAGCCCAGGTTTATAATGCTGAGCGCTAGCCGT
ATTCCTTTTTTTTTTTTTTTGGTTTTATTAAAAGAAGGATTAGTTGCACGCCATGGCGAGAGGAGGCTGTGGTGC
TCAAGGTTTACAAGGCGGCAGTATGCGATTCTAACATGGTTGTGGCTCGACGCAGGACTACAATTCCTCGCCGAC
GCAGTGCGAGGATCTGAGTCTCCTGGAGATCCAGGCTCAGTCGGGTGATTTGAGGTGAGTCTTGGCAGTTGTTTT
GGTCTTGGTGCGTGCTGGGGCCTTTTTAGTCTCTGTTTGAACAAGTGTTTATATATTTCTGCCATGGTTGCCAGT
GTTGAAGCAGCGGACTAGGTGGACAAGAGGCGTGCATCACGTCTGAAGCGGGTCGGTCAAGAGGGTTCAGTTGGC
CCCGCTGGGTTGCTGGATGGAGGCGTGGGATCAAGATGGTGATTGATGGCGACTCGTGGAGTCGGTTCGGCAGAC
AGGTGTACGACGTGAGCGCTGGCAGTATCACATCACGCCGCAGCCGGGTGGCACAAGGTTGCCGTCTATGGCATG
GAGGCGGAAGGCGGCACAGCATGATAATGGTTGAGCCTTGTTTTGACGGCTTTTTATACTGATGCAGGGATGGCA
GCAGGTTCACGCAGGAGCCTCATGCGCCGTCGTCGTCTCTTACAATAGTAGAAGCCCCCCAGCCGTCGCCGCTGC
TGACGATATTCCCCAACGGCTTGCACGCGCCCTACACGCACGACACGAGCGGCTTCTACCAGCCTCAGGGCCCAA
TCCAGTACGCAGCAGCAGATGTGCGGTCTCGCCTAGCGTCCAAGTGAGTTGGCTGTTGTGCGTCTGCTGCCCTGT
CCTGTCTGTCTGCTGCCCTGGCCGTCTGGAGCCTTTTTGGGCCTACTCCCTCTGCCATTGCCTTCACCCGCCCTG
CACTCCCCCCCCCCCTCTCCCCCTCTGCCATTGCACTCACGCCCCCCGTGCACTGCTGCTTTGCGCCACCCCTCC
CTCGGCGTAGACAAGCAGTCTTTTGTCTCTCCTTGCTGTGCTGGTGGTGGATACATGGCTACTACATAGACATGG
CCACATACATGATGCACTGGACAAAGCAGTGCTCAGGAGCTCACCAGTGCGCAGTTCGAGTCCGTCGACGGGCAT
GGCACATGCCCCCAGCCACGGCCACCGCAACACTCAGCACCATCTGCAGATTGGGGCGCGCGAGCAGTACGCAAC
GACGACGCCGTCCTTCCGGAGGGCCTCGGAGCACCTGTCGCGGTCGCCGCCCTTTGCTACGCGGCGCCAGCAGCT
AACGGCGTCGCAGTCGAGCCTTGTGCCGCCGGCCGCCGGCAGGATGGAGGCGGGCCAGTACGGCGGGCGGCAGAG
CCAGCAGGGCGGCGCTCCTCCGCTGCAAGAGGTGCAGACGCTGGGCAGTCTGCAGTACGTGGACCAGAGCATGAC
GCCCATCAAGGTGGACATTACGGGCAAGATGGAAAAGGGGCCCTTTCTGTCGCGCGACCAGGAGTGGACGTGCTA
CCGGCGCAACTACCTGGCCTGTGTCTGCTCGTACTCGCTGCACCCCCTGCACTACCCAAACGTGCCCATACAGTT
TGTGCCGGCCTCGTCGGGCTCCACGGTGCAGGTGTACGGCTTTGCCATGTGCATTTCGGCCGTGGTGGCGGAGAA
TGAGCAGCAGAACATTGAGCTGGTGCAGCACACGCCCAAGCGCGACAAGGGGCCCATCAACAAGCCCTCCAAGGT
GCCGCTGGCGCCCAAGACGGGCCAGGCCTGCCACCACTATGCCGACGCCGCCTCGAGGCCCTATGCCGATGCCCA
GCAGCCGGCGCCCTCCAACGGCCAGCTGCCCTCGGAGCACATGTTTGAGCGCATCCAGTTCAAGCACGCCACGCT
CAACAATGGCAAGCGCCGCGCCGCCCAGCAGTACTACCACCTTGTTGTCGAGCTGTGGGCCGACGTGGGCACCCA
GCTGCCCGACCAGTTTGTCAAGGTGGCCTACCGCAAGTCGGCCAAGATGATTGTCCGCGGCCGCTCCCCCGGCCA
CTACCAAAACGAGCGTCGTGAGAGCCACGGCGACGGCCCGGGAGGCTCTGCCGGCAGCATGGGCGGCTACGGCCA
CATTGGCTCCATGGCCGACTTTGGCTCCAGCCAGATGCTGCCCACGGGCCCCTATGCCTCGACGCCCTACAGCAG
CAGCTCTGCCACCAATGACAGCCGCGGCGCCGCCAATGTCTATCGCCAGCCCCACGATCTGACGCCCGCCGACGA
TGCCGCCGCCCTTGTCACCCCCGACGATGCCTCCAAGATGGGCCTCGACGCCTCGTCCAAGACGTACCAGCACCA
CTACTACTACGACGCCCAGCACGACCGCCCCGACGTCTACCACCACCGCCCCGACGGCATCCTGCCCAGCATTGC
CGCCGACGCCAAGGTCAAGAGCGAGTACGAGTTTGGAGGCATGCTGCCTCGCCCCTACGGCATCACCAACACGGC
TGTCAGCACCCCGCGCATGCTCGACACGCACCACCAGCACCAGCCTCTACACCATCAACACCACCATCCCCTGCT
GCACCACCATTCTGTCCATCACCCGGACCACCACCAGCCGCGCCACCAGGCCCACCAGCGCCAGCAGCCCGACCA
GTTTGCTGACGGCAAGACTACTTCGGCCGCCTATTACCCTTCGATTGTGTCGCCCACGGGCACCGGAATCCACAT
GACCATGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail