Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1273
Gene name
LocationContig_13:251978..253433
Strand+
Gene length (bp)1455
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 1.1E-08 131 224

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5823
Ophiocordyceps australis map64 (Brazil) OphauB2|1273 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04060
Ophiocordyceps camponoti-rufipedis Ophun1|2149
Ophiocordyceps kimflemingae Ophio5|2292
Ophiocordyceps subramaniannii Hirsu2|10883

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1273
MSETSSAVEFHEVCHVDSRHDLLVWTTLEHGDAGQIELDKVLFILDLSKSEGATRPHFFVCCLMEKTAELAAQPF
QLLLLSTDAVPHGLQAEYQLGQMPTHLCGPVDVVISTKSGLGHALAFWETVLLPLWKLVGEAFETRGQPDKVFVT
QNAKSVRQFARHLHVDADQEQLSRTIILLSGDGAVVDLLNGGTRREQDDTMPVPTVALVPLGTGNALFHSLHKPV
VSSSDSSYLLVALRSLFFGVAAPLPVFEASFSPGSRIVTYAEQFGKTEDEAHIVRDDAAVSSLYGAIVASYGFHA
SVVYESDTPEYRVYGDRRFGMVAADLVGQSHGYRAKVLIQRQGSLELEAEPDETHGYVLVTMVSNLERTFNISPA
SKALDGKLRLIRFGCVGGERTMDVMMKAYDGGKHVGMRWDDGNRVDYDQVQVVVVEALDDEARWRKFCIDGTIVD
VPIGGSMTVAKVQGRDMLRVLVDGRVLEAPSAAE*
Coding >OphauB2|1273
ATGTCGGAAACGTCGTCAGCCGTTGAGTTCCATGAGGTTTGCCATGTTGACAGCCGCCATGACCTCCTTGTCTGG
ACGACCCTCGAGCATGGCGACGCAGGCCAAATTGAACTTGACAAGGTGCTTTTTATCTTGGACTTGTCCAAGTCG
GAAGGCGCAACAAGGCCTCATTTTTTTGTTTGCTGCCTGATGGAGAAGACGGCCGAGTTGGCGGCACAGCCATTT
CAACTGCTGCTACTATCGACGGATGCCGTGCCCCATGGTCTCCAGGCAGAGTACCAACTAGGGCAGATGCCCACG
CACCTTTGCGGCCCTGTTGATGTGGTCATCTCGACCAAGTCTGGTCTGGGGCATGCTCTGGCGTTTTGGGAAACA
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGAGACCAGAGGACAGCCGGACAAGGTTTTTGTCACG
CAAAATGCCAAGAGCGTACGACAGTTTGCTCGCCATCTCCATGTAGATGCGGATCAAGAGCAGCTATCAAGGACA
ATAATTCTACTAAGCGGCGACGGCGCAGTGGTGGACCTGCTCAATGGTGGGACCCGTCGAGAGCAAGACGACACA
ATGCCTGTGCCCACTGTTGCTCTTGTTCCATTGGGAACTGGAAATGCCTTGTTTCATTCGTTGCACAAGCCCGTG
GTTTCGAGTAGCGATTCGTCGTATCTGCTTGTTGCTCTGCGAAGTCTGTTTTTTGGCGTTGCGGCGCCTCTTCCT
GTATTTGAAGCATCATTTTCGCCCGGCTCCCGAATCGTTACATATGCGGAGCAGTTTGGAAAGACAGAGGACGAG
GCACACATTGTAAGGGACGATGCGGCCGTGTCAAGCCTCTATGGTGCCATTGTTGCTAGCTACGGCTTCCATGCT
AGCGTCGTCTATGAAAGCGACACACCCGAGTATCGTGTGTACGGGGACAGGCGGTTCGGCATGGTGGCTGCAGAT
CTTGTCGGCCAGTCCCATGGCTATCGCGCCAAGGTGCTGATACAACGGCAGGGGTCGTTGGAGTTGGAGGCAGAG
CCCGACGAGACACATGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGGACTTTTAACATTTCGCCTGCC
AGCAAAGCATTGGACGGCAAGCTGCGTCTGATTCGGTTTGGGTGCGTGGGCGGCGAGCGCACAATGGACGTCATG
ATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAGATGGGACGATGGCAACAGGGTCGACTATGACCAAGTG
CAAGTGGTTGTCGTGGAGGCGTTGGATGATGAGGCACGTTGGCGCAAGTTTTGCATCGACGGCACCATTGTCGAC
GTGCCCATTGGCGGCTCCATGACTGTGGCCAAGGTTCAAGGGCGCGACATGTTGCGCGTCTTGGTTGATGGGCGA
GTTTTGGAGGCGCCAAGTGCAGCCGAGTAG
Transcript >OphauB2|1273
ATGTCGGAAACGTCGTCAGCCGTTGAGTTCCATGAGGTTTGCCATGTTGACAGCCGCCATGACCTCCTTGTCTGG
ACGACCCTCGAGCATGGCGACGCAGGCCAAATTGAACTTGACAAGGTGCTTTTTATCTTGGACTTGTCCAAGTCG
GAAGGCGCAACAAGGCCTCATTTTTTTGTTTGCTGCCTGATGGAGAAGACGGCCGAGTTGGCGGCACAGCCATTT
CAACTGCTGCTACTATCGACGGATGCCGTGCCCCATGGTCTCCAGGCAGAGTACCAACTAGGGCAGATGCCCACG
CACCTTTGCGGCCCTGTTGATGTGGTCATCTCGACCAAGTCTGGTCTGGGGCATGCTCTGGCGTTTTGGGAAACA
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGAGACCAGAGGACAGCCGGACAAGGTTTTTGTCACG
CAAAATGCCAAGAGCGTACGACAGTTTGCTCGCCATCTCCATGTAGATGCGGATCAAGAGCAGCTATCAAGGACA
ATAATTCTACTAAGCGGCGACGGCGCAGTGGTGGACCTGCTCAATGGTGGGACCCGTCGAGAGCAAGACGACACA
ATGCCTGTGCCCACTGTTGCTCTTGTTCCATTGGGAACTGGAAATGCCTTGTTTCATTCGTTGCACAAGCCCGTG
GTTTCGAGTAGCGATTCGTCGTATCTGCTTGTTGCTCTGCGAAGTCTGTTTTTTGGCGTTGCGGCGCCTCTTCCT
GTATTTGAAGCATCATTTTCGCCCGGCTCCCGAATCGTTACATATGCGGAGCAGTTTGGAAAGACAGAGGACGAG
GCACACATTGTAAGGGACGATGCGGCCGTGTCAAGCCTCTATGGTGCCATTGTTGCTAGCTACGGCTTCCATGCT
AGCGTCGTCTATGAAAGCGACACACCCGAGTATCGTGTGTACGGGGACAGGCGGTTCGGCATGGTGGCTGCAGAT
CTTGTCGGCCAGTCCCATGGCTATCGCGCCAAGGTGCTGATACAACGGCAGGGGTCGTTGGAGTTGGAGGCAGAG
CCCGACGAGACACATGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGGACTTTTAACATTTCGCCTGCC
AGCAAAGCATTGGACGGCAAGCTGCGTCTGATTCGGTTTGGGTGCGTGGGCGGCGAGCGCACAATGGACGTCATG
ATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAGATGGGACGATGGCAACAGGGTCGACTATGACCAAGTG
CAAGTGGTTGTCGTGGAGGCGTTGGATGATGAGGCACGTTGGCGCAAGTTTTGCATCGACGGCACCATTGTCGAC
GTGCCCATTGGCGGCTCCATGACTGTGGCCAAGGTTCAAGGGCGCGACATGTTGCGCGTCTTGGTTGATGGGCGA
GTTTTGGAGGCGCCAAGTGCAGCCGAGTAG
Gene >OphauB2|1273
ATGTCGGAAACGTCGTCAGCCGTTGAGTTCCATGAGGTTTGCCATGTTGACAGCCGCCATGACCTCCTTGTCTGG
ACGACCCTCGAGCATGGCGACGCAGGCCAAATTGAACTTGACAAGGTGCTTTTTATCTTGGACTTGTCCAAGTCG
GAAGGCGCAACAAGGCCTCATTTTTTTGTTTGCTGCCTGATGGAGAAGACGGCCGAGTTGGCGGCACAGCCATTT
CAACTGCTGCTACTATCGACGGATGCCGTGCCCCATGGTCTCCAGGCAGAGTACCAACTAGGGCAGATGCCCACG
CACCTTTGCGGCCCTGTTGATGTGGTCATCTCGACCAAGTCTGGTCTGGGGCATGCTCTGGCGTTTTGGGAAACA
GTGTTGCTGCCACTGTGGAAACTGGTTGGTGAGGCATTTGAGACCAGAGGACAGCCGGACAAGGTTTTTGTCACG
CAAAATGCCAAGAGCGTACGACAGTTTGCTCGCCATCTCCATGTAGATGCGGATCAAGAGCAGCTATCAAGGACA
ATAATTCTACTAAGCGGCGACGGCGCAGTGGTGGACCTGCTCAATGGTGGGACCCGTCGAGAGCAAGACGACACA
ATGCCTGTGCCCACTGTTGCTCTTGTTCCATTGGGAACTGGAAATGCCTTGTTTCATTCGTTGCACAAGCCCGTG
GTTTCGAGTAGCGATTCGTCGTATCTGCTTGTTGCTCTGCGAAGTCTGTTTTTTGGCGTTGCGGCGCCTCTTCCT
GTATTTGAAGCATCATTTTCGCCCGGCTCCCGAATCGTTACATATGCGGAGCAGTTTGGAAAGACAGAGGACGAG
GCACACATTGTAAGGGACGATGCGGCCGTGTCAAGCCTCTATGGTGCCATTGTTGCTAGCTACGGCTTCCATGCT
AGCGTCGTCTATGAAAGCGACACACCCGAGTATCGTGTGTACGGGGACAGGCGGTTCGGCATGGTGGCTGCAGAT
CTTGTCGGCCAGTCCCATGGCTATCGCGCCAAGGTGCTGATACAACGGCAGGGGTCGTTGGAGTTGGAGGCAGAG
CCCGACGAGACACATGGCTACGTGCTGGTTACCATGGTGTCCAATCTGGAACGGACTTTTAACATTTCGCCTGCC
AGCAAAGCATTGGACGGCAAGCTGCGTCTGATTCGGTTTGGGTGCGTGGGCGGCGAGCGCACAATGGACGTCATG
ATGAAGGCTTATGACGGCGGCAAACACGTGGGCATGAGATGGGACGATGGCAACAGGGTCGACTATGACCAAGTG
CAAGTGGTTGTCGTGGAGGCGTTGGATGATGAGGCACGTTGGCGCAAGTTTTGCATCGACGGCACCATTGTCGAC
GTGCCCATTGGCGGCTCCATGACTGTGGCCAAGGTTCAAGGGCGCGACATGTTGCGCGTCTTGGTTGATGGGCGA
GTTTTGGAGGCGCCAAGTGCAGCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail