Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1272
Gene name
LocationContig_13:249828..251784
Strand+
Gene length (bp)1956
Transcript length (bp)1956
Coding sequence length (bp)1956
Protein length (aa) 652

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase 1.9E-92 24 462
PF02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase 5.3E-09 482 541

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15565|TRM1_YEAST tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM1 PE=1 SV=1 18 651 2.0E-108
sp|Q9P804|TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm1 PE=1 SV=1 21 647 2.0E-105
sp|Q3TX08|TRM1_MOUSE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Mus musculus GN=Trmt1 PE=1 SV=2 21 649 7.0E-86
sp|Q9VK89|TRM1_DROME Probable tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster GN=CG6388 PE=2 SV=1 45 558 8.0E-84
sp|Q9NXH9|TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens GN=TRMT1 PE=1 SV=1 17 649 2.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15565|TRM1_YEAST tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM1 PE=1 SV=1 18 651 2.0E-108
sp|Q9P804|TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm1 PE=1 SV=1 21 647 2.0E-105
sp|Q3TX08|TRM1_MOUSE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Mus musculus GN=Trmt1 PE=1 SV=2 21 649 7.0E-86
sp|Q9VK89|TRM1_DROME Probable tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster GN=CG6388 PE=2 SV=1 45 558 8.0E-84
sp|Q9NXH9|TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens GN=TRMT1 PE=1 SV=1 17 649 2.0E-82
sp|Q9SRU7|TRM2_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 OS=Arabidopsis thaliana GN=At3g02320 PE=2 SV=3 18 648 3.0E-77
sp|Q9LFU5|TRM1_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 1 OS=Arabidopsis thaliana GN=At5g15810 PE=2 SV=3 18 648 7.0E-76
sp|Q23270|TRM1_CAEEL tRNA (guanine(26)-N(2))-dimethyltransferase OS=Caenorhabditis elegans GN=trm-1 PE=1 SV=1 45 651 9.0E-67
sp|A5UM08|TRM1_METS3 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trm1 PE=3 SV=1 153 541 3.0E-38
sp|Q8SR99|TRM1_ENCCU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=TRM1 PE=1 SV=1 153 542 5.0E-38
sp|O27258|TRM1_METTH tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trm1 PE=3 SV=1 154 541 1.0E-32
sp|Q12Y46|TRM1_METBU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=trm1 PE=3 SV=2 157 537 2.0E-30
sp|A9A871|TRM1_METM6 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=trm1 PE=3 SV=1 154 548 1.0E-27
sp|A6VIL5|TRM1_METM7 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=trm1 PE=3 SV=1 150 548 8.0E-27
sp|A7I9E9|TRM1_METB6 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanoregula boonei (strain 6A8) GN=trm1 PE=3 SV=1 157 538 1.0E-26
sp|P0CW65|TRM1_METMP tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=trm1 PE=3 SV=1 150 548 1.0E-26
sp|P0CW64|TRM1_METMI tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus maripaludis GN=trm1 PE=3 SV=1 150 548 1.0E-26
sp|Q58356|TRM1_METJA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trm1 PE=3 SV=1 150 537 2.0E-26
sp|Q5JIB3|TRM1_THEKO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trm1 PE=3 SV=1 155 541 4.0E-26
sp|A4FZY5|TRM1_METM5 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=trm1 PE=3 SV=1 150 548 4.0E-26
sp|Q2NI56|TRM1_METST tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=trm1 PE=3 SV=1 156 543 2.0E-25
sp|C5A6N2|TRM1_THEGJ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=trm1 PE=3 SV=1 144 537 4.0E-25
sp|O67010|TRM1_AQUAE tRNA (guanine(26)-N(2)/guanine(27)-N(2))-dimethyltransferase OS=Aquifex aeolicus (strain VF5) GN=trm1 PE=1 SV=1 155 438 5.0E-25
sp|O29443|TRM1_ARCFU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trm1 PE=3 SV=1 157 541 3.0E-24
sp|Q9V1P3|TRM1_PYRAB tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trm1 PE=3 SV=2 156 542 6.0E-24
sp|Q3IUJ2|TRM1_NATPD tRNA (guanine(26)-N(2))-dimethyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=trm1 PE=3 SV=1 157 537 1.0E-23
sp|Q8PU28|TRM1_METMA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trm1 PE=3 SV=1 154 541 2.0E-23
sp|Q8TGX6|TRM1_METAC tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trm1 PE=3 SV=1 155 541 1.0E-22
sp|A4YHH9|TRM1_METS5 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trm1 PE=3 SV=1 151 440 1.0E-22
sp|C3MYQ9|TRM1_SULIM tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=trm1 PE=3 SV=1 156 460 2.0E-22
sp|C4KH07|TRM1_SULIK tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=trm1 PE=3 SV=1 156 460 2.0E-22
sp|Q466T6|TRM1_METBF tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=trm1 PE=3 SV=1 155 541 2.0E-22
sp|A2SRK9|TRM1_METLZ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=trm1 PE=3 SV=1 157 544 3.0E-22
sp|C3MPR5|TRM1_SULIL tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=trm1 PE=3 SV=1 156 460 3.0E-22
sp|B8GF12|TRM1_METPE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=trm1 PE=3 SV=1 157 537 4.0E-22
sp|A4WMB7|TRM1_PYRAR tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trm1 PE=3 SV=1 156 345 5.0E-22
sp|C3N5E1|TRM1_SULIA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=trm1 PE=3 SV=1 156 460 5.0E-22
sp|Q4J947|TRM1_SULAC tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trm1 PE=3 SV=1 144 460 1.0E-21
sp|C3NDZ5|TRM1_SULIY tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=trm1 PE=3 SV=1 156 460 1.0E-21
sp|C3NHQ8|TRM1_SULIN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=trm1 PE=3 SV=1 156 460 1.0E-21
sp|B1YCV9|TRM1_PYRNV tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=trm1 PE=3 SV=1 156 345 1.0E-21
sp|B6YUU9|TRM1_THEON tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermococcus onnurineus (strain NA1) GN=trm1 PE=3 SV=1 153 543 2.0E-21
sp|O59493|TRM1_PYRHO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=trm1 PE=1 SV=1 156 536 2.0E-21
sp|A1RV26|TRM1_PYRIL tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=trm1 PE=3 SV=1 154 330 2.0E-21
sp|Q9YDY7|TRM1_AERPE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trm1 PE=3 SV=3 157 537 3.0E-21
sp|P57705|TRM1_HALSA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trm1 PE=3 SV=1 150 454 4.0E-21
sp|B0R713|TRM1_HALS3 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=trm1 PE=3 SV=1 150 454 4.0E-21
sp|Q97ZH0|TRM1_SULSO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trm1 PE=3 SV=1 156 460 6.0E-21
sp|A3CW75|TRM1_METMJ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=trm1 PE=3 SV=1 150 542 2.0E-20
sp|Q97AR2|TRM1_THEVO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=trm1 PE=3 SV=1 155 547 2.0E-20
sp|Q8ZWT5|TRM1_PYRAE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trm1 PE=3 SV=1 156 330 4.0E-20
sp|P81554|TRM1_PYRFU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trm1 PE=1 SV=1 156 343 4.0E-20
sp|Q5UYV8|TRM1_HALMA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trm1 PE=3 SV=1 148 532 1.0E-19
sp|A3MTQ5|TRM1_PYRCJ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=trm1 PE=3 SV=1 156 330 1.0E-19
sp|Q8TYY7|TRM1_METKA tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trm1 PE=3 SV=1 156 343 2.0E-19
sp|B9LSI7|TRM1_HALLT tRNA (guanine(26)-N(2))-dimethyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=trm1 PE=3 SV=1 150 532 3.0E-19
sp|Q18EA0|TRM1_HALWD tRNA (guanine(26)-N(2))-dimethyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=trm1 PE=3 SV=1 150 472 5.0E-19
sp|A6UUN6|TRM1_META3 tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=trm1 PE=3 SV=1 154 544 2.0E-18
sp|Q971V9|TRM1_SULTO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trm1 PE=3 SV=1 150 460 3.0E-18
sp|Q2FN43|TRM1_METHJ tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=trm1 PE=3 SV=1 157 537 4.0E-17
sp|P57706|TRM1_THEAC tRNA (guanine(26)-N(2))-dimethyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trm1 PE=3 SV=1 155 359 2.0E-16
sp|Q4R6C7|TRM1L_MACFA TRMT1-like protein OS=Macaca fascicularis GN=TRMT1L PE=2 SV=1 144 544 3.0E-09
sp|A5D7S3|TRM1L_BOVIN TRMT1-like protein OS=Bos taurus GN=TRMT1L PE=2 SV=1 144 544 8.0E-09
sp|Q496Z9|TRM1L_RAT TRMT1-like protein OS=Rattus norvegicus GN=Trmt1l PE=2 SV=1 144 544 1.0E-08
sp|A2RSY6|TRM1L_MOUSE TRMT1-like protein OS=Mus musculus GN=Trmt1l PE=1 SV=1 144 363 1.0E-08
sp|Q7Z2T5|TRM1L_HUMAN TRMT1-like protein OS=Homo sapiens GN=TRMT1L PE=1 SV=2 144 544 1.0E-08
sp|Q5R5T0|TRM1L_PONAB TRMT1-like protein OS=Pongo abelii GN=TRMT1L PE=2 SV=1 144 544 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004809 tRNA (guanine-N2-)-methyltransferase activity Yes
GO:0008033 tRNA processing Yes
GO:0003723 RNA binding Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0008175 tRNA methyltransferase activity No
GO:0008168 methyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140098 catalytic activity, acting on RNA No
GO:0006396 RNA processing No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0006399 tRNA metabolic process No
GO:0008150 biological_process No
GO:0008173 RNA methyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0034660 ncRNA metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0008170 N-methyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0034470 ncRNA processing No
GO:0097159 organic cyclic compound binding No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1272
MTDAGSNSELIERHGKQYRPITEGKATILVPSSATPKGSDEEQQVFYNPVQQYNRDLSCLAIKAYGEWTLQQRQQ
DLQSKAAAKQAKRGQKRKRQDGDSPLEHESGLKQERNMQEAQLEAADAGAKLSSYSEAHLEPGPQDPTANAESPK
PPSFKILDALSASGLRAMRYAHELSFVTSVVANDLSASASESIKLNIEYNGLQDIVSVSNDDALALMYRGIADDL
SRRHRRGNPGRSHKFDVIDLDPYGTAAPFFDAAIQSIRDDGGLLCITCTDSAVWAGHSYCEKTYAMYGGIPLKGM
HSHEAALRLILGAIASSGAKYGLAIEPLLSLSIDFYTKFFVRVSRSPQAVKFLGAKMMLLYSCDQGCGAWEMQPL
LKSKPTPNKKGSGSFYKHGMALSPTCDRFCTHCGFKTHLSGPMYAGYIHSQEFIQRVLDEIPKASPQVYGTLARL
EGMLRTTQEEFLREAESPQDVDPREAEMAALDPCAFFVIPGRVASIVSCATPNDDMFRGALRHLGYQVGRSHCRP
GSIKTDAPWSTIWWIMTEWIRQKSPVKTSKFKPSMAGWKILRDAGLLEEEEEEGAAKAHVQEPNQAAENGIKDAN
GKTQPESELRKTLVFNEALASLGRQRATQRYVRYQVNPQRYWGPMTKAKGS*
Coding >OphauB2|1272
ATGACCGATGCAGGTAGCAATTCAGAGCTCATTGAGCGACATGGAAAGCAGTACCGACCCATTACCGAAGGCAAG
GCCACGATATTGGTACCATCATCGGCCACACCAAAGGGCAGCGACGAGGAGCAGCAAGTTTTTTACAATCCAGTC
CAACAGTACAACCGCGACCTGTCTTGCTTGGCCATCAAAGCCTATGGGGAATGGACTCTGCAACAAAGACAGCAA
GATTTGCAATCCAAAGCCGCTGCCAAGCAGGCCAAAAGGGGCCAGAAGAGAAAACGTCAAGATGGTGACAGCCCG
CTCGAGCATGAGTCGGGTCTGAAGCAGGAGCGCAACATGCAAGAAGCTCAGCTCGAAGCAGCCGATGCAGGTGCT
AAACTATCAAGCTATTCCGAGGCACACCTGGAGCCAGGTCCTCAAGACCCGACAGCAAACGCCGAGTCCCCAAAG
CCACCATCCTTCAAGATTCTCGACGCCCTGTCGGCCTCGGGCCTTCGCGCTATGCGCTATGCGCATGAACTTTCC
TTTGTCACCTCAGTCGTAGCCAATGACCTCTCAGCATCGGCTTCCGAGTCCATCAAACTCAATATCGAGTACAAT
GGCTTGCAAGACATTGTTTCTGTCTCCAACGACGACGCGCTCGCGCTCATGTACCGTGGCATAGCGGACGATTTG
TCTCGACGCCATCGTCGTGGAAACCCTGGCCGCTCGCATAAATTTGATGTCATTGACTTGGATCCCTATGGCACT
GCGGCGCCCTTTTTCGACGCCGCAATCCAGTCTATACGAGATGATGGAGGATTACTTTGCATCACTTGCACTGAT
AGTGCTGTTTGGGCCGGCCACAGCTACTGCGAGAAGACGTATGCCATGTATGGCGGCATCCCTCTCAAGGGCATG
CACTCACACGAAGCGGCATTGCGTCTGATTCTCGGTGCCATTGCTTCGTCTGGGGCCAAGTACGGACTAGCTATC
GAGCCCCTGCTATCGCTTTCAATCGACTTCTACACAAAGTTTTTTGTTCGAGTCAGTAGGTCTCCACAAGCGGTC
AAATTCCTCGGCGCCAAGATGATGCTTCTGTACAGCTGCGACCAAGGCTGCGGCGCATGGGAAATGCAGCCGCTG
CTCAAGAGTAAACCAACGCCCAACAAAAAGGGGAGCGGTTCCTTTTACAAGCATGGAATGGCGCTAAGCCCAACA
TGTGACCGCTTCTGCACGCATTGTGGGTTCAAGACACATCTTAGTGGACCCATGTATGCGGGATACATTCACTCG
CAAGAATTCATCCAAAGAGTTCTTGACGAGATTCCAAAGGCGTCGCCACAAGTCTATGGAACGCTTGCTCGGCTT
GAGGGCATGTTGCGGACCACGCAGGAAGAGTTCCTGCGGGAAGCCGAGTCGCCACAGGACGTTGACCCAAGGGAA
GCAGAAATGGCGGCACTTGACCCTTGCGCTTTTTTTGTAATACCGGGCAGAGTGGCCAGCATTGTATCTTGCGCG
ACTCCCAACGATGACATGTTTCGCGGGGCGTTGCGACACTTGGGCTACCAGGTAGGCCGAAGCCACTGTCGACCG
GGCAGCATCAAGACGGACGCGCCTTGGTCGACAATCTGGTGGATAATGACGGAGTGGATTCGTCAAAAGTCTCCG
GTCAAAACTAGCAAGTTTAAGCCCAGCATGGCTGGCTGGAAAATTTTGCGCGACGCTGGGCTTCTTGAAGAAGAA
GAAGAAGAAGGCGCTGCTAAAGCGCATGTGCAGGAACCAAATCAGGCCGCTGAAAATGGGATAAAAGATGCCAAC
GGCAAGACACAGCCAGAGAGCGAGCTGCGCAAGACGCTCGTCTTCAACGAAGCACTGGCCAGTCTAGGCCGTCAG
CGAGCGACGCAGCGTTACGTGAGATACCAAGTGAACCCTCAGCGCTACTGGGGGCCCATGACCAAGGCCAAGGGC
AGCTGA
Transcript >OphauB2|1272
ATGACCGATGCAGGTAGCAATTCAGAGCTCATTGAGCGACATGGAAAGCAGTACCGACCCATTACCGAAGGCAAG
GCCACGATATTGGTACCATCATCGGCCACACCAAAGGGCAGCGACGAGGAGCAGCAAGTTTTTTACAATCCAGTC
CAACAGTACAACCGCGACCTGTCTTGCTTGGCCATCAAAGCCTATGGGGAATGGACTCTGCAACAAAGACAGCAA
GATTTGCAATCCAAAGCCGCTGCCAAGCAGGCCAAAAGGGGCCAGAAGAGAAAACGTCAAGATGGTGACAGCCCG
CTCGAGCATGAGTCGGGTCTGAAGCAGGAGCGCAACATGCAAGAAGCTCAGCTCGAAGCAGCCGATGCAGGTGCT
AAACTATCAAGCTATTCCGAGGCACACCTGGAGCCAGGTCCTCAAGACCCGACAGCAAACGCCGAGTCCCCAAAG
CCACCATCCTTCAAGATTCTCGACGCCCTGTCGGCCTCGGGCCTTCGCGCTATGCGCTATGCGCATGAACTTTCC
TTTGTCACCTCAGTCGTAGCCAATGACCTCTCAGCATCGGCTTCCGAGTCCATCAAACTCAATATCGAGTACAAT
GGCTTGCAAGACATTGTTTCTGTCTCCAACGACGACGCGCTCGCGCTCATGTACCGTGGCATAGCGGACGATTTG
TCTCGACGCCATCGTCGTGGAAACCCTGGCCGCTCGCATAAATTTGATGTCATTGACTTGGATCCCTATGGCACT
GCGGCGCCCTTTTTCGACGCCGCAATCCAGTCTATACGAGATGATGGAGGATTACTTTGCATCACTTGCACTGAT
AGTGCTGTTTGGGCCGGCCACAGCTACTGCGAGAAGACGTATGCCATGTATGGCGGCATCCCTCTCAAGGGCATG
CACTCACACGAAGCGGCATTGCGTCTGATTCTCGGTGCCATTGCTTCGTCTGGGGCCAAGTACGGACTAGCTATC
GAGCCCCTGCTATCGCTTTCAATCGACTTCTACACAAAGTTTTTTGTTCGAGTCAGTAGGTCTCCACAAGCGGTC
AAATTCCTCGGCGCCAAGATGATGCTTCTGTACAGCTGCGACCAAGGCTGCGGCGCATGGGAAATGCAGCCGCTG
CTCAAGAGTAAACCAACGCCCAACAAAAAGGGGAGCGGTTCCTTTTACAAGCATGGAATGGCGCTAAGCCCAACA
TGTGACCGCTTCTGCACGCATTGTGGGTTCAAGACACATCTTAGTGGACCCATGTATGCGGGATACATTCACTCG
CAAGAATTCATCCAAAGAGTTCTTGACGAGATTCCAAAGGCGTCGCCACAAGTCTATGGAACGCTTGCTCGGCTT
GAGGGCATGTTGCGGACCACGCAGGAAGAGTTCCTGCGGGAAGCCGAGTCGCCACAGGACGTTGACCCAAGGGAA
GCAGAAATGGCGGCACTTGACCCTTGCGCTTTTTTTGTAATACCGGGCAGAGTGGCCAGCATTGTATCTTGCGCG
ACTCCCAACGATGACATGTTTCGCGGGGCGTTGCGACACTTGGGCTACCAGGTAGGCCGAAGCCACTGTCGACCG
GGCAGCATCAAGACGGACGCGCCTTGGTCGACAATCTGGTGGATAATGACGGAGTGGATTCGTCAAAAGTCTCCG
GTCAAAACTAGCAAGTTTAAGCCCAGCATGGCTGGCTGGAAAATTTTGCGCGACGCTGGGCTTCTTGAAGAAGAA
GAAGAAGAAGGCGCTGCTAAAGCGCATGTGCAGGAACCAAATCAGGCCGCTGAAAATGGGATAAAAGATGCCAAC
GGCAAGACACAGCCAGAGAGCGAGCTGCGCAAGACGCTCGTCTTCAACGAAGCACTGGCCAGTCTAGGCCGTCAG
CGAGCGACGCAGCGTTACGTGAGATACCAAGTGAACCCTCAGCGCTACTGGGGGCCCATGACCAAGGCCAAGGGC
AGCTGA
Gene >OphauB2|1272
ATGACCGATGCAGGTAGCAATTCAGAGCTCATTGAGCGACATGGAAAGCAGTACCGACCCATTACCGAAGGCAAG
GCCACGATATTGGTACCATCATCGGCCACACCAAAGGGCAGCGACGAGGAGCAGCAAGTTTTTTACAATCCAGTC
CAACAGTACAACCGCGACCTGTCTTGCTTGGCCATCAAAGCCTATGGGGAATGGACTCTGCAACAAAGACAGCAA
GATTTGCAATCCAAAGCCGCTGCCAAGCAGGCCAAAAGGGGCCAGAAGAGAAAACGTCAAGATGGTGACAGCCCG
CTCGAGCATGAGTCGGGTCTGAAGCAGGAGCGCAACATGCAAGAAGCTCAGCTCGAAGCAGCCGATGCAGGTGCT
AAACTATCAAGCTATTCCGAGGCACACCTGGAGCCAGGTCCTCAAGACCCGACAGCAAACGCCGAGTCCCCAAAG
CCACCATCCTTCAAGATTCTCGACGCCCTGTCGGCCTCGGGCCTTCGCGCTATGCGCTATGCGCATGAACTTTCC
TTTGTCACCTCAGTCGTAGCCAATGACCTCTCAGCATCGGCTTCCGAGTCCATCAAACTCAATATCGAGTACAAT
GGCTTGCAAGACATTGTTTCTGTCTCCAACGACGACGCGCTCGCGCTCATGTACCGTGGCATAGCGGACGATTTG
TCTCGACGCCATCGTCGTGGAAACCCTGGCCGCTCGCATAAATTTGATGTCATTGACTTGGATCCCTATGGCACT
GCGGCGCCCTTTTTCGACGCCGCAATCCAGTCTATACGAGATGATGGAGGATTACTTTGCATCACTTGCACTGAT
AGTGCTGTTTGGGCCGGCCACAGCTACTGCGAGAAGACGTATGCCATGTATGGCGGCATCCCTCTCAAGGGCATG
CACTCACACGAAGCGGCATTGCGTCTGATTCTCGGTGCCATTGCTTCGTCTGGGGCCAAGTACGGACTAGCTATC
GAGCCCCTGCTATCGCTTTCAATCGACTTCTACACAAAGTTTTTTGTTCGAGTCAGTAGGTCTCCACAAGCGGTC
AAATTCCTCGGCGCCAAGATGATGCTTCTGTACAGCTGCGACCAAGGCTGCGGCGCATGGGAAATGCAGCCGCTG
CTCAAGAGTAAACCAACGCCCAACAAAAAGGGGAGCGGTTCCTTTTACAAGCATGGAATGGCGCTAAGCCCAACA
TGTGACCGCTTCTGCACGCATTGTGGGTTCAAGACACATCTTAGTGGACCCATGTATGCGGGATACATTCACTCG
CAAGAATTCATCCAAAGAGTTCTTGACGAGATTCCAAAGGCGTCGCCACAAGTCTATGGAACGCTTGCTCGGCTT
GAGGGCATGTTGCGGACCACGCAGGAAGAGTTCCTGCGGGAAGCCGAGTCGCCACAGGACGTTGACCCAAGGGAA
GCAGAAATGGCGGCACTTGACCCTTGCGCTTTTTTTGTAATACCGGGCAGAGTGGCCAGCATTGTATCTTGCGCG
ACTCCCAACGATGACATGTTTCGCGGGGCGTTGCGACACTTGGGCTACCAGGTAGGCCGAAGCCACTGTCGACCG
GGCAGCATCAAGACGGACGCGCCTTGGTCGACAATCTGGTGGATAATGACGGAGTGGATTCGTCAAAAGTCTCCG
GTCAAAACTAGCAAGTTTAAGCCCAGCATGGCTGGCTGGAAAATTTTGCGCGACGCTGGGCTTCTTGAAGAAGAA
GAAGAAGAAGGCGCTGCTAAAGCGCATGTGCAGGAACCAAATCAGGCCGCTGAAAATGGGATAAAAGATGCCAAC
GGCAAGACACAGCCAGAGAGCGAGCTGCGCAAGACGCTCGTCTTCAACGAAGCACTGGCCAGTCTAGGCCGTCAG
CGAGCGACGCAGCGTTACGTGAGATACCAAGTGAACCCTCAGCGCTACTGGGGGCCCATGACCAAGGCCAAGGGC
AGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail