Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1269
Gene name
LocationContig_13:243310..244723
Strand+
Gene length (bp)1413
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03907 Spo7 Spo7-like protein 3.1E-83 45 301

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0019888 protein phosphatase regulator activity Yes
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0019208 phosphatase regulator activity No
GO:0030234 enzyme regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 76 95 19
2 132 154 22
3 186 208 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1269
MMADELDSIVKGAPVTPRASRLHRERRRDREQDDGSGDPLSHTPSSPSMVYLNLLILEASLRAQFLELRARRRHH
TFFLVLLACWVAFFGQRLLLSPPSQDDSLEPLPGVGKARDKQDAVAAANAALWALEGAQRVCFMGGLTTAVLVWA
TGIWERGVRWPRRWFAISNRGLRALNCKLVIVRRPWWTEVLSAIAFFLTYGLFSHTASSSYRLVRAELLYETERE
MRRLFPASPASHASHPSLTLPTPLEDDEQDGHEEDLAPGGDYVKLLLLAKPFSPTFRENWELYRSEYWERENERR
ALLRKRVKEHDRRMAQQLYGWFWWLPWRLMQPLKYAQDQTHHHHQHAKSHLGRQSMSDKSRKRRGSSNSVRRPSV
STPRSQTPTLEAVFDDGAGLQRQGSATEKRRRKPAASLSTGSRARRPGSEVRSATPVSETSSSPLAHETGPETEG
AVTTSRSTRSSTAKAMQTFK*
Coding >OphauB2|1269
ATGATGGCTGATGAGCTCGACTCAATCGTCAAGGGCGCTCCCGTCACGCCCAGGGCCTCGAGGCTGCACCGAGAG
CGTCGTCGAGACCGGGAGCAGGACGACGGCAGCGGCGACCCCCTGAGCCATACTCCAAGCTCACCGTCAATGGTC
TATCTCAACCTCTTGATTCTCGAAGCCTCGCTGCGTGCCCAATTTCTCGAGCTGCGCGCCCGCCGCCGCCATCAC
ACCTTCTTTCTTGTTCTCCTTGCTTGTTGGGTAGCGTTTTTTGGCCAGCGACTACTGCTCTCGCCTCCGAGCCAA
GACGATAGTCTGGAGCCTCTGCCCGGTGTGGGAAAAGCCAGGGATAAGCAAGATGCAGTAGCTGCTGCCAATGCC
GCTCTCTGGGCTCTCGAAGGCGCCCAACGTGTCTGCTTCATGGGTGGCCTCACAACGGCTGTCCTGGTTTGGGCC
ACGGGCATCTGGGAACGTGGCGTGCGTTGGCCGCGCCGTTGGTTCGCCATATCTAATCGGGGCTTGCGTGCCCTC
AACTGTAAGCTGGTGATTGTCCGTCGTCCCTGGTGGACCGAGGTCTTGTCCGCCATTGCTTTTTTCCTCACATAT
GGTCTCTTTTCCCATACTGCCAGCTCATCCTACCGCCTCGTCCGAGCAGAGCTACTGTACGAAACGGAGCGAGAG
ATGCGTCGTCTATTCCCAGCGTCGCCAGCATCGCATGCAAGCCACCCCAGCCTCACACTCCCCACCCCCCTCGAG
GACGACGAGCAAGACGGTCATGAAGAGGACTTGGCGCCTGGCGGAGACTATGTCAAGCTCCTGCTGCTGGCAAAA
CCCTTTTCACCCACTTTTCGCGAAAATTGGGAGCTCTACCGGTCTGAGTACTGGGAGCGCGAGAATGAACGTCGG
GCTCTGCTGCGTAAAAGGGTCAAGGAACACGACCGCCGCATGGCCCAGCAGCTCTACGGCTGGTTTTGGTGGCTT
CCGTGGCGCCTCATGCAGCCGCTCAAGTATGCACAAGACCAAACACACCACCATCACCAGCACGCAAAATCTCAT
TTGGGCCGCCAGTCCATGAGCGACAAGAGCCGCAAGCGTAGGGGCAGCAGCAACAGTGTGCGCCGGCCTTCGGTC
AGCACGCCTCGGAGTCAGACACCCACACTCGAGGCAGTCTTTGACGACGGCGCCGGTCTTCAGCGTCAAGGATCC
GCTACAGAAAAGAGGCGCAGGAAGCCGGCGGCCAGTTTAAGCACGGGCTCGCGAGCAAGACGGCCTGGCAGCGAA
GTGCGCTCGGCAACGCCCGTGTCCGAGACGTCATCGTCGCCGCTGGCACACGAGACAGGCCCAGAGACTGAAGGG
GCGGTGACGACGAGTCGAAGCACACGTAGTTCAACGGCAAAGGCGATGCAGACCTTCAAGTAA
Transcript >OphauB2|1269
ATGATGGCTGATGAGCTCGACTCAATCGTCAAGGGCGCTCCCGTCACGCCCAGGGCCTCGAGGCTGCACCGAGAG
CGTCGTCGAGACCGGGAGCAGGACGACGGCAGCGGCGACCCCCTGAGCCATACTCCAAGCTCACCGTCAATGGTC
TATCTCAACCTCTTGATTCTCGAAGCCTCGCTGCGTGCCCAATTTCTCGAGCTGCGCGCCCGCCGCCGCCATCAC
ACCTTCTTTCTTGTTCTCCTTGCTTGTTGGGTAGCGTTTTTTGGCCAGCGACTACTGCTCTCGCCTCCGAGCCAA
GACGATAGTCTGGAGCCTCTGCCCGGTGTGGGAAAAGCCAGGGATAAGCAAGATGCAGTAGCTGCTGCCAATGCC
GCTCTCTGGGCTCTCGAAGGCGCCCAACGTGTCTGCTTCATGGGTGGCCTCACAACGGCTGTCCTGGTTTGGGCC
ACGGGCATCTGGGAACGTGGCGTGCGTTGGCCGCGCCGTTGGTTCGCCATATCTAATCGGGGCTTGCGTGCCCTC
AACTGTAAGCTGGTGATTGTCCGTCGTCCCTGGTGGACCGAGGTCTTGTCCGCCATTGCTTTTTTCCTCACATAT
GGTCTCTTTTCCCATACTGCCAGCTCATCCTACCGCCTCGTCCGAGCAGAGCTACTGTACGAAACGGAGCGAGAG
ATGCGTCGTCTATTCCCAGCGTCGCCAGCATCGCATGCAAGCCACCCCAGCCTCACACTCCCCACCCCCCTCGAG
GACGACGAGCAAGACGGTCATGAAGAGGACTTGGCGCCTGGCGGAGACTATGTCAAGCTCCTGCTGCTGGCAAAA
CCCTTTTCACCCACTTTTCGCGAAAATTGGGAGCTCTACCGGTCTGAGTACTGGGAGCGCGAGAATGAACGTCGG
GCTCTGCTGCGTAAAAGGGTCAAGGAACACGACCGCCGCATGGCCCAGCAGCTCTACGGCTGGTTTTGGTGGCTT
CCGTGGCGCCTCATGCAGCCGCTCAAGTATGCACAAGACCAAACACACCACCATCACCAGCACGCAAAATCTCAT
TTGGGCCGCCAGTCCATGAGCGACAAGAGCCGCAAGCGTAGGGGCAGCAGCAACAGTGTGCGCCGGCCTTCGGTC
AGCACGCCTCGGAGTCAGACACCCACACTCGAGGCAGTCTTTGACGACGGCGCCGGTCTTCAGCGTCAAGGATCC
GCTACAGAAAAGAGGCGCAGGAAGCCGGCGGCCAGTTTAAGCACGGGCTCGCGAGCAAGACGGCCTGGCAGCGAA
GTGCGCTCGGCAACGCCCGTGTCCGAGACGTCATCGTCGCCGCTGGCACACGAGACAGGCCCAGAGACTGAAGGG
GCGGTGACGACGAGTCGAAGCACACGTAGTTCAACGGCAAAGGCGATGCAGACCTTCAAGTAA
Gene >OphauB2|1269
ATGATGGCTGATGAGCTCGACTCAATCGTCAAGGGCGCTCCCGTCACGCCCAGGGCCTCGAGGCTGCACCGAGAG
CGTCGTCGAGACCGGGAGCAGGACGACGGCAGCGGCGACCCCCTGAGCCATACTCCAAGCTCACCGTCAATGGTC
TATCTCAACCTCTTGATTCTCGAAGCCTCGCTGCGTGCCCAATTTCTCGAGCTGCGCGCCCGCCGCCGCCATCAC
ACCTTCTTTCTTGTTCTCCTTGCTTGTTGGGTAGCGTTTTTTGGCCAGCGACTACTGCTCTCGCCTCCGAGCCAA
GACGATAGTCTGGAGCCTCTGCCCGGTGTGGGAAAAGCCAGGGATAAGCAAGATGCAGTAGCTGCTGCCAATGCC
GCTCTCTGGGCTCTCGAAGGCGCCCAACGTGTCTGCTTCATGGGTGGCCTCACAACGGCTGTCCTGGTTTGGGCC
ACGGGCATCTGGGAACGTGGCGTGCGTTGGCCGCGCCGTTGGTTCGCCATATCTAATCGGGGCTTGCGTGCCCTC
AACTGTAAGCTGGTGATTGTCCGTCGTCCCTGGTGGACCGAGGTCTTGTCCGCCATTGCTTTTTTCCTCACATAT
GGTCTCTTTTCCCATACTGCCAGCTCATCCTACCGCCTCGTCCGAGCAGAGCTACTGTACGAAACGGAGCGAGAG
ATGCGTCGTCTATTCCCAGCGTCGCCAGCATCGCATGCAAGCCACCCCAGCCTCACACTCCCCACCCCCCTCGAG
GACGACGAGCAAGACGGTCATGAAGAGGACTTGGCGCCTGGCGGAGACTATGTCAAGCTCCTGCTGCTGGCAAAA
CCCTTTTCACCCACTTTTCGCGAAAATTGGGAGCTCTACCGGTCTGAGTACTGGGAGCGCGAGAATGAACGTCGG
GCTCTGCTGCGTAAAAGGGTCAAGGAACACGACCGCCGCATGGCCCAGCAGCTCTACGGCTGGTTTTGGTGGCTT
CCGTGGCGCCTCATGCAGCCGCTCAAGTATGCACAAGACCAAACACACCACCATCACCAGCACGCAAAATCTCAT
TTGGGCCGCCAGTCCATGAGCGACAAGAGCCGCAAGCGTAGGGGCAGCAGCAACAGTGTGCGCCGGCCTTCGGTC
AGCACGCCTCGGAGTCAGACACCCACACTCGAGGCAGTCTTTGACGACGGCGCCGGTCTTCAGCGTCAAGGATCC
GCTACAGAAAAGAGGCGCAGGAAGCCGGCGGCCAGTTTAAGCACGGGCTCGCGAGCAAGACGGCCTGGCAGCGAA
GTGCGCTCGGCAACGCCCGTGTCCGAGACGTCATCGTCGCCGCTGGCACACGAGACAGGCCCAGAGACTGAAGGG
GCGGTGACGACGAGTCGAAGCACACGTAGTTCAACGGCAAAGGCGATGCAGACCTTCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail