Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1267
Gene name
LocationContig_13:236203..240034
Strand+
Gene length (bp)3831
Transcript length (bp)3585
Coding sequence length (bp)3585
Protein length (aa) 1195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.3E-12 679 769
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 3.1E-45 781 934
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 3.6E-44 56 220
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.8E-08 244 324
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.9E-16 562 668
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 6.4E-16 1102 1185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 564 980 1.0E-63
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 568 1188 7.0E-60
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 561 981 1.0E-43
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 65 303 1.0E-27
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 624 961 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 564 980 1.0E-63
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 568 1188 7.0E-60
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 561 981 1.0E-43
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 65 303 1.0E-27
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 624 961 7.0E-21
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 562 990 8.0E-20
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 587 1001 1.0E-19
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 548 990 3.0E-19
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 627 991 4.0E-19
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 547 998 3.0E-18
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 66 311 4.0E-18
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 562 933 6.0E-18
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 570 932 3.0E-17
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 555 998 3.0E-17
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 518 933 6.0E-17
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 626 990 7.0E-17
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 583 1016 5.0E-16
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 605 933 2.0E-15
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 570 932 4.0E-15
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 624 934 4.0E-12
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 661 934 2.0E-10
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 73 331 2.0E-10
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 119 252 5.0E-10
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 119 252 1.0E-09
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 661 934 2.0E-09
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 83 252 3.0E-09
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 117 252 1.0E-08
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 119 252 2.0E-08
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 59 252 1.0E-07
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 22 238 3.0E-07
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 525 932 4.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 589 923 6.0E-07
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 119 252 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 137 159 22
3 199 221 22
4 682 704 22
5 735 757 22
6 812 834 22
7 849 871 22
8 878 900 22
9 915 937 22
10 950 972 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1267
MANLFDSIPSWANTIRPDAAFLDSSPWLDSTLFPRAESQSPVDKAKEASGIGIVNFLSAISTAVTLFTIQLLLFV
LLRNKLARIYKPRTYLVPERERTEPPPRNILALIRVIFNYDDREVIKKCGLDAYFFLRYLKTLLVIFVPICAIVL
PILIPINYIDGKGHDVDPKSVNNATRNSTPSGLDTLAWNNVNPAHTSRYTAHLVMAILVVCWVCTVFFFELRVYI
KVRQDHLTSAEHRLRASATTVLVNSIPKKWLSEEALMGLFDVFPGGVRNIWLNRDLTTLLDKISIRRSVHSRLES
AETDLIKAAKKAQLKQKAAEEKKWRKQQKLKALTKEEIAARNAAQDEEANRMANSGEGIYAGADGNVSLRDNYES
NGLRVKTSHDVHELDTVEEEDGQEQPGGFMMTSVKNPLSKVGKGVPALLPRRTDDVLPSRLSTESPEAPRSHSRA
TSGVSENSTGPIKKTVHATAAGNTVREVGEDDDMYMPGRTRFWQFWKPPTGSYASPVPQGPRVEDQPSRKRSMWQ
KLKALVPFTGKKHEPLNEYPPACNPDRKADQDDGAEWQKYLKAKHRPTHRLPLFGINWMPGLPLINKKVDTIYWC
RQELARLNLEIEQDQKHPERFPLMRSAFIRFNHQAAAHMACQSVVHHIPRQMAPRMNEISPRDVVWDNMALTWWQ
EWLRTAIVILIISGMVFLWALPVAWTAALSQLDKIITQGTWLGQLLKSDLAITVLKAISGVLPAAILAGLLAIVP
GILRLLAQFMGAKTGAQKSESLNEFIGNLTKLQSVGAVLDLLANNLPASANYFFSYMALQALATSSGTLFQLSAL
VMWFIIAPLFDSTARSKWSRNISLAQIQWGSFFPVYTNFACIGLVYCVIAPLISVFAIVTFSLLWLAQRYAMLYV
NRFEVDTGGVLYPRAINQTFTGIYFMELCMAGLFFIVQDTHKNRTCTPHGIVMIIVFLLTVGYQIILNLSFSPLF
RYLPVTFEDEAVLRDEAFQRAQDARFAQSDQDRQYDDEAATDTGLGEYDYGPSAETKDIGLDKNELHAPRQGHHL
REHVKQVGAWAKDSGNQIRKIKAKTDNSKALQYRRKQRRRDLEAQRAMGDALYGGYHDEIEDLTPEERDMLTRHA
FLHYALRVRRPVVWIPRDDLGISDDEIRRTRDYSEYIWMSNEGTALDSKMRVVYGQNPPDFSEDDIINL*
Coding >OphauB2|1267
ATGGCGAATCTCTTCGACTCAATACCATCATGGGCCAACACGATCCGTCCAGACGCAGCTTTCTTGGACTCCTCG
CCATGGCTGGATTCGACCTTGTTTCCGCGAGCCGAGAGCCAAAGCCCGGTCGATAAGGCAAAAGAGGCTAGTGGC
ATTGGTATAGTCAACTTCTTGTCTGCCATAAGTACGGCAGTCACTCTCTTCACCATTCAGCTACTACTATTCGTC
CTATTGCGCAACAAGCTGGCCAGAATATACAAACCCCGAACATACTTGGTCCCAGAGCGAGAACGTACAGAACCG
CCGCCACGAAACATTCTCGCCTTGATCAGAGTCATCTTCAACTACGATGATCGAGAAGTCATCAAGAAATGTGGC
CTCGACGCTTACTTCTTTCTTCGCTACCTCAAGACTCTACTCGTCATATTCGTGCCAATATGTGCCATCGTTCTT
CCTATACTGATTCCTATCAACTACATTGACGGCAAGGGCCATGATGTCGACCCCAAGTCAGTCAATAATGCCACT
CGCAACAGCACCCCCTCGGGCCTCGACACGTTGGCATGGAACAATGTCAATCCCGCCCACACAAGCCGCTATACT
GCGCATCTCGTCATGGCCATCCTCGTCGTTTGTTGGGTTTGCACAGTATTCTTCTTTGAACTACGAGTATACATC
AAAGTTCGCCAGGACCATCTCACAAGCGCAGAGCATCGGCTTCGCGCCTCAGCCACCACCGTCCTCGTCAACTCA
ATCCCCAAGAAATGGCTCAGCGAGGAGGCTCTTATGGGATTGTTCGATGTGTTTCCGGGTGGTGTGAGAAACATA
TGGCTTAATCGCGACTTAACAACTCTTCTCGACAAGATTTCCATTCGCCGCAGCGTCCATTCTCGATTGGAAAGC
GCTGAGACGGACCTCATCAAAGCCGCCAAGAAGGCTCAGCTGAAGCAAAAGGCAGCTGAGGAAAAGAAGTGGCGC
AAGCAGCAGAAACTCAAGGCTCTCACTAAGGAGGAGATAGCTGCACGTAATGCTGCTCAGGACGAAGAAGCAAAT
CGAATGGCCAACAGTGGTGAAGGCATTTATGCCGGCGCTGATGGAAACGTATCTCTCAGAGACAATTATGAATCA
AACGGTCTGCGTGTCAAGACGAGCCACGATGTTCATGAACTGGACACTGTCGAGGAAGAAGATGGCCAGGAGCAG
CCTGGCGGCTTCATGATGACGAGCGTCAAGAATCCCTTGTCTAAAGTTGGCAAAGGAGTGCCGGCTTTATTACCA
CGCAGGACTGACGACGTGTTGCCTTCGCGACTTTCCACTGAATCCCCTGAAGCGCCCCGCAGCCATTCCCGAGCC
ACTTCTGGGGTCTCGGAAAACTCGACGGGTCCCATCAAGAAGACAGTACACGCAACAGCCGCTGGAAATACTGTG
CGAGAAGTGGGAGAGGACGATGACATGTATATGCCTGGTCGAACAAGATTTTGGCAGTTTTGGAAACCGCCGACA
GGCTCATACGCCTCTCCTGTTCCACAGGGTCCGAGGGTCGAGGACCAGCCGAGCCGTAAGAGGTCCATGTGGCAA
AAGCTTAAGGCCTTGGTTCCGTTTACGGGCAAGAAGCACGAGCCGCTCAACGAGTATCCGCCGGCATGCAATCCG
GATAGGAAAGCAGACCAAGACGATGGAGCTGAGTGGCAAAAGTACCTCAAGGCTAAGCATCGTCCAACACATCGA
CTTCCTCTCTTTGGAATAAACTGGATGCCCGGCCTTCCTTTGATCAACAAAAAGGTGGATACAATCTATTGGTGT
CGACAAGAGCTTGCCCGGTTGAATCTGGAAATCGAGCAAGATCAAAAGCACCCGGAGCGCTTCCCGCTCATGAGA
TCAGCCTTTATTCGCTTCAACCACCAGGCAGCGGCACATATGGCATGTCAGAGCGTTGTGCACCACATTCCTCGA
CAGATGGCGCCTCGCATGAACGAGATTTCACCCCGAGACGTCGTGTGGGACAACATGGCCCTGACATGGTGGCAA
GAGTGGCTTCGAACAGCCATTGTCATCCTCATCATCTCGGGCATGGTTTTCCTGTGGGCGCTTCCTGTGGCGTGG
ACGGCAGCTCTCAGCCAGCTCGACAAGATCATCACCCAGGGCACCTGGCTAGGACAATTACTCAAGAGTGACTTG
GCGATAACAGTCCTCAAGGCCATTTCTGGTGTTTTGCCTGCAGCCATTCTGGCCGGGTTGCTCGCAATCGTCCCT
GGCATTCTTCGCCTCTTGGCTCAGTTCATGGGTGCCAAGACGGGTGCTCAAAAGAGCGAGTCGCTCAACGAATTT
ATTGGAAACTTGACAAAGCTGCAGTCGGTTGGTGCTGTTTTGGATCTTCTAGCCAACAATCTACCCGCCTCGGCC
AACTATTTCTTTTCCTACATGGCTCTTCAAGCCCTTGCAACGAGCTCTGGCACTCTGTTTCAGCTTTCTGCTCTC
GTCATGTGGTTCATCATCGCACCGCTTTTCGACAGCACAGCCAGAAGCAAGTGGTCCCGAAACATATCGCTCGCT
CAAATTCAATGGGGCTCCTTCTTCCCGGTCTACACAAACTTTGCCTGTATTGGACTTGTGTATTGCGTCATTGCG
CCCTTGATTTCCGTCTTCGCTATTGTCACCTTTAGTCTTTTGTGGCTTGCCCAACGATACGCCATGCTCTACGTT
AACAGATTTGAGGTCGACACTGGTGGCGTTTTGTATCCGCGGGCCATCAACCAGACCTTTACCGGCATTTACTTT
ATGGAGCTTTGCATGGCTGGCCTATTCTTCATCGTTCAGGATACGCACAAGAATCGCACCTGTACTCCACATGGC
ATAGTCATGATTATTGTCTTTCTCCTCACGGTCGGCTATCAGATCATCCTTAACCTGTCATTTTCACCACTCTTT
AGGTACCTTCCAGTCACATTTGAAGACGAAGCAGTACTACGGGACGAGGCCTTTCAACGAGCTCAGGATGCCCGG
TTTGCGCAGTCGGATCAAGACCGACAGTATGATGACGAAGCAGCAACAGATACGGGCTTGGGAGAGTATGACTAT
GGTCCATCGGCCGAAACCAAGGACATTGGCCTCGACAAGAACGAATTGCATGCTCCTAGGCAAGGGCATCATCTG
CGGGAGCATGTCAAGCAAGTTGGCGCATGGGCCAAGGACAGCGGCAACCAGATCCGCAAGATTAAGGCGAAAACG
GACAATTCAAAAGCTTTGCAATATCGACGAAAACAGCGGCGTCGAGATCTTGAAGCCCAAAGAGCAATGGGCGAC
GCACTATATGGTGGATACCACGATGAAATCGAGGATTTGACTCCAGAAGAGCGCGACATGCTCACGCGACATGCA
TTTTTGCATTACGCGCTTCGAGTACGCCGGCCAGTGGTATGGATCCCACGCGACGACTTGGGAATCAGCGATGAC
GAGATACGGCGCACGCGAGACTATAGCGAATATATCTGGATGAGCAACGAGGGGACGGCGCTCGACAGTAAGATG
CGCGTCGTCTATGGTCAAAATCCACCAGACTTCTCAGAAGACGACATAATCAATCTTTGA
Transcript >OphauB2|1267
ATGGCGAATCTCTTCGACTCAATACCATCATGGGCCAACACGATCCGTCCAGACGCAGCTTTCTTGGACTCCTCG
CCATGGCTGGATTCGACCTTGTTTCCGCGAGCCGAGAGCCAAAGCCCGGTCGATAAGGCAAAAGAGGCTAGTGGC
ATTGGTATAGTCAACTTCTTGTCTGCCATAAGTACGGCAGTCACTCTCTTCACCATTCAGCTACTACTATTCGTC
CTATTGCGCAACAAGCTGGCCAGAATATACAAACCCCGAACATACTTGGTCCCAGAGCGAGAACGTACAGAACCG
CCGCCACGAAACATTCTCGCCTTGATCAGAGTCATCTTCAACTACGATGATCGAGAAGTCATCAAGAAATGTGGC
CTCGACGCTTACTTCTTTCTTCGCTACCTCAAGACTCTACTCGTCATATTCGTGCCAATATGTGCCATCGTTCTT
CCTATACTGATTCCTATCAACTACATTGACGGCAAGGGCCATGATGTCGACCCCAAGTCAGTCAATAATGCCACT
CGCAACAGCACCCCCTCGGGCCTCGACACGTTGGCATGGAACAATGTCAATCCCGCCCACACAAGCCGCTATACT
GCGCATCTCGTCATGGCCATCCTCGTCGTTTGTTGGGTTTGCACAGTATTCTTCTTTGAACTACGAGTATACATC
AAAGTTCGCCAGGACCATCTCACAAGCGCAGAGCATCGGCTTCGCGCCTCAGCCACCACCGTCCTCGTCAACTCA
ATCCCCAAGAAATGGCTCAGCGAGGAGGCTCTTATGGGATTGTTCGATGTGTTTCCGGGTGGTGTGAGAAACATA
TGGCTTAATCGCGACTTAACAACTCTTCTCGACAAGATTTCCATTCGCCGCAGCGTCCATTCTCGATTGGAAAGC
GCTGAGACGGACCTCATCAAAGCCGCCAAGAAGGCTCAGCTGAAGCAAAAGGCAGCTGAGGAAAAGAAGTGGCGC
AAGCAGCAGAAACTCAAGGCTCTCACTAAGGAGGAGATAGCTGCACGTAATGCTGCTCAGGACGAAGAAGCAAAT
CGAATGGCCAACAGTGGTGAAGGCATTTATGCCGGCGCTGATGGAAACGTATCTCTCAGAGACAATTATGAATCA
AACGGTCTGCGTGTCAAGACGAGCCACGATGTTCATGAACTGGACACTGTCGAGGAAGAAGATGGCCAGGAGCAG
CCTGGCGGCTTCATGATGACGAGCGTCAAGAATCCCTTGTCTAAAGTTGGCAAAGGAGTGCCGGCTTTATTACCA
CGCAGGACTGACGACGTGTTGCCTTCGCGACTTTCCACTGAATCCCCTGAAGCGCCCCGCAGCCATTCCCGAGCC
ACTTCTGGGGTCTCGGAAAACTCGACGGGTCCCATCAAGAAGACAGTACACGCAACAGCCGCTGGAAATACTGTG
CGAGAAGTGGGAGAGGACGATGACATGTATATGCCTGGTCGAACAAGATTTTGGCAGTTTTGGAAACCGCCGACA
GGCTCATACGCCTCTCCTGTTCCACAGGGTCCGAGGGTCGAGGACCAGCCGAGCCGTAAGAGGTCCATGTGGCAA
AAGCTTAAGGCCTTGGTTCCGTTTACGGGCAAGAAGCACGAGCCGCTCAACGAGTATCCGCCGGCATGCAATCCG
GATAGGAAAGCAGACCAAGACGATGGAGCTGAGTGGCAAAAGTACCTCAAGGCTAAGCATCGTCCAACACATCGA
CTTCCTCTCTTTGGAATAAACTGGATGCCCGGCCTTCCTTTGATCAACAAAAAGGTGGATACAATCTATTGGTGT
CGACAAGAGCTTGCCCGGTTGAATCTGGAAATCGAGCAAGATCAAAAGCACCCGGAGCGCTTCCCGCTCATGAGA
TCAGCCTTTATTCGCTTCAACCACCAGGCAGCGGCACATATGGCATGTCAGAGCGTTGTGCACCACATTCCTCGA
CAGATGGCGCCTCGCATGAACGAGATTTCACCCCGAGACGTCGTGTGGGACAACATGGCCCTGACATGGTGGCAA
GAGTGGCTTCGAACAGCCATTGTCATCCTCATCATCTCGGGCATGGTTTTCCTGTGGGCGCTTCCTGTGGCGTGG
ACGGCAGCTCTCAGCCAGCTCGACAAGATCATCACCCAGGGCACCTGGCTAGGACAATTACTCAAGAGTGACTTG
GCGATAACAGTCCTCAAGGCCATTTCTGGTGTTTTGCCTGCAGCCATTCTGGCCGGGTTGCTCGCAATCGTCCCT
GGCATTCTTCGCCTCTTGGCTCAGTTCATGGGTGCCAAGACGGGTGCTCAAAAGAGCGAGTCGCTCAACGAATTT
ATTGGAAACTTGACAAAGCTGCAGTCGGTTGGTGCTGTTTTGGATCTTCTAGCCAACAATCTACCCGCCTCGGCC
AACTATTTCTTTTCCTACATGGCTCTTCAAGCCCTTGCAACGAGCTCTGGCACTCTGTTTCAGCTTTCTGCTCTC
GTCATGTGGTTCATCATCGCACCGCTTTTCGACAGCACAGCCAGAAGCAAGTGGTCCCGAAACATATCGCTCGCT
CAAATTCAATGGGGCTCCTTCTTCCCGGTCTACACAAACTTTGCCTGTATTGGACTTGTGTATTGCGTCATTGCG
CCCTTGATTTCCGTCTTCGCTATTGTCACCTTTAGTCTTTTGTGGCTTGCCCAACGATACGCCATGCTCTACGTT
AACAGATTTGAGGTCGACACTGGTGGCGTTTTGTATCCGCGGGCCATCAACCAGACCTTTACCGGCATTTACTTT
ATGGAGCTTTGCATGGCTGGCCTATTCTTCATCGTTCAGGATACGCACAAGAATCGCACCTGTACTCCACATGGC
ATAGTCATGATTATTGTCTTTCTCCTCACGGTCGGCTATCAGATCATCCTTAACCTGTCATTTTCACCACTCTTT
AGGTACCTTCCAGTCACATTTGAAGACGAAGCAGTACTACGGGACGAGGCCTTTCAACGAGCTCAGGATGCCCGG
TTTGCGCAGTCGGATCAAGACCGACAGTATGATGACGAAGCAGCAACAGATACGGGCTTGGGAGAGTATGACTAT
GGTCCATCGGCCGAAACCAAGGACATTGGCCTCGACAAGAACGAATTGCATGCTCCTAGGCAAGGGCATCATCTG
CGGGAGCATGTCAAGCAAGTTGGCGCATGGGCCAAGGACAGCGGCAACCAGATCCGCAAGATTAAGGCGAAAACG
GACAATTCAAAAGCTTTGCAATATCGACGAAAACAGCGGCGTCGAGATCTTGAAGCCCAAAGAGCAATGGGCGAC
GCACTATATGGTGGATACCACGATGAAATCGAGGATTTGACTCCAGAAGAGCGCGACATGCTCACGCGACATGCA
TTTTTGCATTACGCGCTTCGAGTACGCCGGCCAGTGGTATGGATCCCACGCGACGACTTGGGAATCAGCGATGAC
GAGATACGGCGCACGCGAGACTATAGCGAATATATCTGGATGAGCAACGAGGGGACGGCGCTCGACAGTAAGATG
CGCGTCGTCTATGGTCAAAATCCACCAGACTTCTCAGAAGACGACATAATCAATCTTTGA
Gene >OphauB2|1267
ATGGCGAATCTCTTCGACTCAATACCATCATGGGCCAACACGATCCGTCCAGACGCAGCTTTCTTGGACTCCTCG
CCATGGCTGGATTCGACCTTGTTTCCGCGAGCCGAGAGCCAAAGCCCGGTCGATAAGGCAAAAGAGGCTAGTGGC
ATTGGTATAGTCAACTTCTTGTCTGCCATAAGTACGGCAGTCACTCTCTTCACCATTCAGCTACTACTATTCGTC
CTATTGCGCAACAAGCTGGCCAGAATATAGTACGTGAGCAACGCTCCTTTCATCACCCCCATGCGCTGCTGACCT
TTCTGAAGCAAACCCCGAACATACTTGGTCCCAGAGCGAGAACGTACAGAACCGCCGCCACGAAACATTCTCGCC
TTGATCAGAGTCATCTTCAACTACGATGATCGAGAAGTCATCAAGAAATGTGGCCTCGACGCTTACTTCTTTCTT
CGCTACCTCAAGACTCTACTCGTCATATTCGTGCCAATATGTGCCATCGTTCTTCCTATACTGATTCCTATCAAC
TACATTGACGGCAAGGGCCATGATGTCGACCCCAAGTCAGTCAATAATGCCACTCGCAACAGCACCCCCTCGGGC
CTCGACACGTTGGCATGGAACAATGTCAATCCCGCCCACACAAGCCGCTATACTGCGCATCTCGTCATGGCCATC
CTCGTCGTTTGTTGGGTTTGCACAGTATTCTTCTTTGAACTACGAGTATACATCAAAGTTCGCCAGGACCATCTC
ACAAGCGCAGAGCATCGGCTTCGCGCCTCAGCCACCACCGTCCTCGTCAACTCAATCCCCAAGAAATGGCTCAGC
GAGGAGGCTCTTATGGGATTGTTCGATGTGTTTCCGGGTGGTGTGAGAAACATATGGCTTAATCGCGACTTAACA
ACTCTTCTCGACAAGATTTCCATTCGCCGCAGCGTCCATTCTCGATTGGAAAGCGCTGAGACGGACCTCATCAAA
GCCGCCAAGAAGGCTCAGCTGAAGCAAAAGGCAGCTGAGGAAAAGAAGTGGCGCAAGCAGCAGAAACTCAAGGCT
CTCACTAAGGAGGAGATAGCTGCACGTAATGCTGCTCAGGACGAAGAAGCAAATCGAATGGCCAACAGTGGTGAA
GGCATTTATGCCGGCGCTGATGGAAACGTATCTCTCAGAGACAATTATGAATCAAACGGTCTGCGTGTCAAGACG
AGCCACGATGTTCATGAACTGGACACTGTCGAGGAAGAAGATGGCCAGGAGCAGCCTGGCGGCTTCATGATGACG
AGCGTCAAGAATCCCTTGTCTAAAGTTGGCAAAGGTATCAAGGGAATCGCTACCAAGACTGACAATAACGTGAAT
GACACCCTCAACAGGAGTGCCGGCTTTATTACCACGTCGCATATCGATGGACAAAGCAGGACGCCCGAGTTACTG
GATGCCTCACGCGCTCAAGGCAGGACTGACGACGTGTTGCCTTCGCGACTTTCCACTGAATCCCCTGAAGCGCCC
CGCAGCCATTCCCGAGCCACTTCTGGGGTCTCGGAAAACTCGACGGGTCCCATCAAGAAGACAGTACACGCAACA
GCCGCTGGAAATACTGTGCGAGAAGTGGGAGAGGACGATGACATGTATATGCCTGGTCGAACAAGATTTTGGCAG
TTTTGGAAACCGCCGACAGGCTCATACGCCTCTCCTGTTCCACAGGGTCCGAGGGTCGAGGACCAGCCGAGCCGT
AAGAGGTCCATGTGGCAAAAGCTTAAGGCCTTGGTTCCGTTTACGGGCAAGAAGCACGAGCCGCTCAACGAGTAT
CCGCCGGCATGCAATCCGGATAGGAAAGCAGACCAAGACGATGGAGCTGAGTGGCAAAAGTACCTCAAGGCTAAG
CATCGTCCAACACATCGACTTCCTCTCTTTGGAATAAACTGGATGCCCGGCCTTCCTTTGATCAACAAAAAGGTG
GATACAATCTATTGGTGTCGACAAGAGCTTGCCCGGTTGAATCTGGAAATCGAGCAAGATCAAAAGCACCCGGAG
CGCTTCCCGCTCATGAGATCAGCCTTTATTCGCTTCAACCACCAGGCAGCGGCACATATGGCATGTCAGAGCGTT
GTGCACCACATTCCTCGACAGATGGCGCCTCGCATGAACGAGATTTCACCCCGAGACGTCGTGTGGGACAACATG
GCCCTGACATGGTGGCAAGAGTGGCTTCGAACAGCCATTGTCATCCTCATCATCTCGGGCATGGTTTTCCTGTGG
GCGCTTCCTGTGGCGTGGACGGCAGCTCTCAGCCAGCTCGACAAGATCATCACCCAGGGCACCTGGCTAGGACAA
TTACTCAAGAGTGACTTGGCGATAACAGTCCTCAAGGCCATTTCTGGTGTTTTGCCTGCAGCCATTCTGGCCGGG
TTGCTCGCAATCGTCCCTGGCATTCTTCGCCTCTTGGCTCAGTTCATGGGTGCCAAGACGGGTGCTCAAAAGAGC
GAGTTTGTACAAGTATTCTACTTCATCTTCCTCTTTTTCCAAGTCTTCCTCATTGTCTCAATAGCTTCCTTCTTT
GCAAGGTCGCTCAACGAATTTATTGGAAACTTGACAAAGCTGCAGTCGGTTGGTGCTGTTTTGGATCTTCTAGCC
AACAATCTACCCGCCTCGGCCAACTATTTCTTTTCCTACATGGCTCTTCAAGCCCTTGCAACGAGCTCTGGCACT
CTGTTTCAGCTTTCTGCTCTCGTCATGTGGTTCATCATCGCACCGCTTTTCGACAGCACAGCCAGAAGCAAGTGG
TCCCGAAACATATCGCTCGCTCAAATTCAATGGGGCTCCTTCTTCCCGGTCTACACAAACTTTGCCTGTATTGGA
CTTGTGTATTGCGTCATTGCGCCCTTGATTTCCGTCTTCGCTATTGTCACCTTTAGTCTTTTGTGGCTTGCCCAA
CGATACGCCATGCTCTACGTTAACAGATTTGAGGTCGACACTGGTGGCGTTTTGTATCCGCGGGCCATCAACCAG
ACCTTTACCGGCATTTACTTTATGGAGCTTTGCATGGCTGGCCTATTCTTCATCGTTCAGGATACGCACAAGAAT
CGCACCTGTACTCCACATGGCATAGTCATGATTATTGTCTTTCTCCTCACGGTCGGCTATCAGATCATCCTTAAC
CTGTCATTTTCACCACTCTTTAGGTACCTTCCAGTCACATTTGAAGACGAAGCAGTACTACGGGACGAGGCCTTT
CAACGAGCTCAGGATGCCCGGTTTGCGCAGTCGGATCAAGACCGACAGTATGATGACGAAGCAGCAACAGATACG
GGCTTGGGAGAGTATGACTATGGTCCATCGGCCGAAACCAAGGACATTGGCCTCGACAAGAACGAATTGCATGCT
CCTAGGCAAGGGCATCATCTGCGGGAGCATGTCAAGCAAGTTGGCGCATGGGCCAAGGACAGCGGCAACCAGATC
CGCAAGATTAAGGCGAAAACGGACAATTCAAAAGCTTTGCAATATCGACGAAAACAGCGGCGTCGAGATCTTGAA
GCCCAAAGAGCAATGGGCGACGCACTATATGGTGGATACCACGATGAAATCGAGGATTTGACTCCAGAAGAGCGC
GACATGCTCACGCGACATGCATTTTTGCATTACGCGCTTCGAGTACGCCGGCCAGTGGTATGGATCCCACGCGAC
GACTTGGGAATCAGCGATGACGAGATACGGCGCACGCGAGACTATAGCGAATATATCTGGATGAGCAACGAGGGG
ACGGCGCTCGACAGTAAGATGCGCGTCGTCTATGGTCAAAATCCACCAGACTTCTCAGAAGACGACATAATCAAT
CTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail