Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1264
Gene name
LocationContig_13:228132..231138
Strand-
Gene length (bp)3006
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04191 PEMT Phospholipid methyltransferase 5.9E-21 213 313
PF04191 PEMT Phospholipid methyltransferase 2.4E-34 484 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FZ62|CHO2_ARTOC Phosphatidylethanolamine N-methyltransferase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CHO2 PE=3 SV=1 3 931 0.0E+00
sp|C1G565|CHO2_PARBD Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides brasiliensis (strain Pb18) GN=CHO2 PE=3 SV=1 19 956 0.0E+00
sp|C0NLX2|CHO2_AJECG Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CHO2 PE=3 SV=1 2 957 0.0E+00
sp|C1GZK1|CHO2_PARBA Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CHO2 PE=3 SV=2 19 956 0.0E+00
sp|B6QG32|CHO2_TALMQ Phosphatidylethanolamine N-methyltransferase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cho2 PE=3 SV=1 23 954 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FZ62|CHO2_ARTOC Phosphatidylethanolamine N-methyltransferase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CHO2 PE=3 SV=1 3 931 0.0E+00
sp|C1G565|CHO2_PARBD Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides brasiliensis (strain Pb18) GN=CHO2 PE=3 SV=1 19 956 0.0E+00
sp|C0NLX2|CHO2_AJECG Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CHO2 PE=3 SV=1 2 957 0.0E+00
sp|C1GZK1|CHO2_PARBA Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CHO2 PE=3 SV=2 19 956 0.0E+00
sp|B6QG32|CHO2_TALMQ Phosphatidylethanolamine N-methyltransferase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cho2 PE=3 SV=1 23 954 0.0E+00
sp|B8MBN3|CHO2_TALSN Phosphatidylethanolamine N-methyltransferase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cho2 PE=3 SV=1 23 954 0.0E+00
sp|C6H4B5|CHO2_AJECH Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces capsulatus (strain H143) GN=CHO2 PE=3 SV=1 2 957 0.0E+00
sp|Q4WZS1|CHO2_ASPFU Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cho2 PE=3 SV=1 22 904 0.0E+00
sp|B0XUW3|CHO2_ASPFC Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cho2 PE=3 SV=1 22 904 0.0E+00
sp|D4DGR3|CHO2_TRIVH Phosphatidylethanolamine N-methyltransferase OS=Trichophyton verrucosum (strain HKI 0517) GN=CHO2 PE=3 SV=1 3 948 0.0E+00
sp|D1ZIW5|CHO2_SORMK Phosphatidylethanolamine N-methyltransferase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CHO2 PE=3 SV=1 11 953 0.0E+00
sp|Q5BBC6|CHO2_EMENI Phosphatidylethanolamine N-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cho2 PE=3 SV=1 30 934 0.0E+00
sp|Q0U2R3|CHO2_PHANO Phosphatidylethanolamine N-methyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CHO2 PE=3 SV=2 13 951 0.0E+00
sp|D4AT37|CHO2_ARTBC Phosphatidylethanolamine N-methyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CHO2 PE=3 SV=1 34 948 0.0E+00
sp|Q6C6U9|CHO2_YARLI Phosphatidylethanolamine N-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHO2 PE=3 SV=1 2 939 0.0E+00
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 390 948 0.0E+00
sp|B6JWP7|CHO2_SCHJY Phosphatidylethanolamine N-methyltransferase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=cho2 PE=3 SV=1 2 947 0.0E+00
sp|O74787|CHO2_SCHPO Phosphatidylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho2 PE=1 SV=1 12 937 0.0E+00
sp|B0D4E6|CHO2_LACBS Phosphatidylethanolamine N-methyltransferase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CHO2 PE=3 SV=1 11 935 0.0E+00
sp|C5GN10|CHO2_AJEDR Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CHO2 PE=3 SV=1 2 957 0.0E+00
sp|C7Z7C3|CHO2_NECH7 Phosphatidylethanolamine N-methyltransferase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CHO2 PE=3 SV=1 18 958 0.0E+00
sp|Q7SAJ6|CHO2_NEUCR Phosphatidylethanolamine N-methyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chol-1 PE=3 SV=1 29 953 0.0E+00
sp|A4RHN5|CHO2_MAGO7 Phosphatidylethanolamine N-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHO2 PE=3 SV=1 9 953 0.0E+00
sp|C0RZV6|CHO2_PARBP Phosphatidylethanolamine N-methyltransferase OS=Paracoccidioides brasiliensis (strain Pb03) GN=CHO2 PE=3 SV=2 32 956 0.0E+00
sp|Q2H0U8|CHO2_CHAGB Phosphatidylethanolamine N-methyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHO2 PE=3 SV=1 23 953 0.0E+00
sp|A6S950|CHO2_BOTFB Phosphatidylethanolamine N-methyltransferase OS=Botryotinia fuckeliana (strain B05.10) GN=CHO2 PE=3 SV=1 30 958 0.0E+00
sp|C5PEI5|CHO2_COCP7 Phosphatidylethanolamine N-methyltransferase OS=Coccidioides posadasii (strain C735) GN=CHO2 PE=3 SV=1 8 952 0.0E+00
sp|B2B2N5|CHO2_PODAN Phosphatidylethanolamine N-methyltransferase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CHO2 PE=3 SV=1 3 954 0.0E+00
sp|Q2UDE5|CHO2_ASPOR Phosphatidylethanolamine N-methyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cho2 PE=3 SV=1 25 951 0.0E+00
sp|B8N6H2|CHO2_ASPFN Phosphatidylethanolamine N-methyltransferase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cho2 PE=3 SV=1 25 951 0.0E+00
sp|Q0CVD7|CHO2_ASPTN Phosphatidylethanolamine N-methyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cho2 PE=3 SV=1 29 940 0.0E+00
sp|C4JDF8|CHO2_UNCRE Phosphatidylethanolamine N-methyltransferase OS=Uncinocarpus reesii (strain UAMH 1704) GN=CHO2 PE=3 SV=1 34 952 0.0E+00
sp|B6HJA3|CHO2_PENRW Phosphatidylethanolamine N-methyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cho2 PE=3 SV=1 22 954 0.0E+00
sp|A1C7T5|CHO2_ASPCL Phosphatidylethanolamine N-methyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cho2 PE=3 SV=1 22 950 0.0E+00
sp|A2R616|CHO2_ASPNC Phosphatidylethanolamine N-methyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cho2 PE=3 SV=1 19 958 0.0E+00
sp|A1DIF7|CHO2_NEOFI Phosphatidylethanolamine N-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=CHO2 PE=3 SV=1 22 948 0.0E+00
sp|C5JCV0|CHO2_AJEDS Phosphatidylethanolamine N-methyltransferase OS=Ajellomyces dermatitidis (strain SLH14081) GN=CHO2 PE=3 SV=1 2 957 0.0E+00
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 11 320 1.0E-131
sp|Q6BY28|CHO2_DEBHA Phosphatidylethanolamine N-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CHO2 PE=3 SV=2 23 938 1.0E-131
sp|A5DL79|CHO2_PICGU Phosphatidylethanolamine N-methyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CHO2 PE=3 SV=2 25 938 8.0E-128
sp|A7TLA7|CHO22_VANPO Phosphatidylethanolamine N-methyltransferase 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-2 PE=3 SV=1 29 934 1.0E-124
sp|A8PRN6|CHO2_MALGO Phosphatidylethanolamine N-methyltransferase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CHO2 PE=3 SV=1 28 935 2.0E-122
sp|A5DS78|CHO2_LODEL Phosphatidylethanolamine N-methyltransferase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CHO2 PE=3 SV=1 36 865 2.0E-122
sp|C4QXE9|CHO2_PICPG Phosphatidylethanolamine N-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=CHO2 PE=3 SV=1 34 934 1.0E-121
sp|A3LQW6|CHO2_PICST Phosphatidylethanolamine N-methyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CHO2 PE=3 SV=2 23 938 2.0E-121
sp|Q6FVB6|CHO2_CANGA Phosphatidylethanolamine N-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CHO2 PE=3 SV=1 33 849 4.0E-119
sp|C5M4D4|CHO2_CANTT Phosphatidylethanolamine N-methyltransferase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CHO2 PE=3 SV=1 25 943 3.0E-117
sp|Q59LV5|CHO2_CANAL Phosphatidylethanolamine N-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHO2 PE=3 SV=1 26 938 3.0E-117
sp|Q754G0|CHO2_ASHGO Phosphatidylethanolamine N-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CHO2 PE=3 SV=1 39 904 6.0E-117
sp|B5VJA0|CHO2_YEAS6 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=CHO2 PE=3 SV=1 39 897 1.0E-116
sp|C4Y206|CHO2_CLAL4 Phosphatidylethanolamine N-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=CHO2 PE=3 SV=1 36 832 3.0E-116
sp|B3LI73|CHO2_YEAS1 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=CHO2 PE=3 SV=1 39 897 5.0E-116
sp|C7GQ65|CHO2_YEAS2 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain JAY291) GN=CHO2 PE=3 SV=1 39 897 7.0E-116
sp|A6ZUG8|CHO2_YEAS7 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=CHO2 PE=3 SV=1 39 897 7.0E-116
sp|B9WL59|CHO2_CANDC Phosphatidylethanolamine N-methyltransferase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CHO2 PE=3 SV=1 26 940 9.0E-116
sp|C8Z951|CHO2_YEAS8 Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=CHO2 PE=3 SV=1 39 897 1.0E-115
sp|P05374|CHO2_YEAST Phosphatidylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHO2 PE=1 SV=1 39 897 1.0E-115
sp|C4YL78|CHO2_CANAW Phosphatidylethanolamine N-methyltransferase OS=Candida albicans (strain WO-1) GN=CHO2 PE=3 SV=1 26 938 1.0E-115
sp|Q6CJI9|CHO2_KLULA Phosphatidylethanolamine N-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CHO2 PE=3 SV=1 37 908 1.0E-113
sp|C5DZU3|CHO2_ZYGRC Phosphatidylethanolamine N-methyltransferase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=CHO2 PE=3 SV=1 39 934 9.0E-113
sp|C5DGB6|CHO2_LACTC Phosphatidylethanolamine N-methyltransferase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=CHO2 PE=3 SV=1 29 617 1.0E-110
sp|A7TNI7|CHO21_VANPO Phosphatidylethanolamine N-methyltransferase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-1 PE=3 SV=1 22 590 3.0E-104
sp|C5DGB6|CHO2_LACTC Phosphatidylethanolamine N-methyltransferase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=CHO2 PE=3 SV=1 717 904 3.0E-13
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 65 312 5.0E-13
sp|A7TNI7|CHO21_VANPO Phosphatidylethanolamine N-methyltransferase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CHO2-1 PE=3 SV=1 716 934 1.0E-12
sp|B2WFD4|CHO2_PYRTR Phosphatidylethanolamine N-methyltransferase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cho2 PE=3 SV=1 372 586 7.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 68 87 19
2 92 114 22
3 174 196 22
4 209 226 17
5 270 292 22
6 370 392 22
7 402 421 19
8 450 472 22
9 482 504 22
10 541 563 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1264
MEAALDRPVGQSELRRRHSRNGTKQQTEAKGNKTFGRTADGTIFVVPATHDMVSQLLDPRQPKNLSDALVLAILV
LHIFAAYSLPVAWKRPVFAFVFLCWRAAYNIGIGILLHVQSHHGRLITWARRWKLFEDPKSSDNPRPWLYRLIKR
ELEAKIPQDYQLELAPIEYNTWLVFRRVVDLILMCDFVSYCLFAIVCGQTPRGERLVMTAMRWSLGLVLVGFNIW
VKLDAHRVVKDFAWYWGDFFYLIDQDLTFDGVFELAPHPMYSIGYAGYYGISMMAASYEVLFISIVAHVAQFAFL
LTVENPHIEKTYNPPPPRVRILTDSRGEPGSQADAADEECVTASLSSRSFHPSESPAAVHDMVGLGSIDLFRLPD
CVVFLMPFYVALVTLATPSTPPWQAAFIVHALVWRIWYHLGLGIILDQQSKAKMWTRHFLKFGEGANEAWRQWKA
MMHVSMIMCNTALIASCWKMYAPPQAWVSGLALLRHIVGASLIALQLWTAVSVYNSLGEFGWFCGDFFFDHGVKL
TYTSIYRFLNNPERIFGTAGVWGAALITWSRFIFIMAIVTQFMSLYYLSFIERPHMQKIYGRSLREEAGLTKFLK
RSLPPPVKGWQQSMDKVVDDTSHFVADFIEFARPKFASGVKTIVRDTSALFNVAPARLTITRITPGVAGLDSKHY
SLVVQGTASAPSSSRDRSTGKESIRGRFPKGIKTMSYEYGTPLKVKWRAPAGHSEQDWIGLYMVTDNRSRDSTEV
SSLGRWAPTNSGVYDALTADSSIVKDEQPVAADDGVSPRLVEGEVVFEGDRLWWTQGVFEFRYHHDGNHNAMTIS
EPFEIGISPFVDSESEAEGLPEGKTAYSRAVEAAMLPVVRNCLDRDPDIAPSTVEELFGSHVERDAKYSRRIVYA
IREIFGIEFAPAVVLADGNVRKLAWRICNAKAVLAPFSMSPSRGTATPARRDFEHEEASS*
Coding >OphauB2|1264
ATGGAAGCTGCACTTGACAGGCCTGTTGGCCAATCTGAGTTGCGCAGGCGGCACTCTCGCAATGGCACGAAGCAG
CAGACCGAGGCCAAGGGCAACAAGACTTTTGGCCGAACCGCCGACGGCACAATCTTTGTGGTACCAGCGACCCAT
GACATGGTCTCGCAGTTGCTAGACCCTCGCCAGCCAAAGAACCTGTCAGACGCCTTGGTCCTGGCCATTCTAGTC
CTGCACATCTTTGCTGCTTATTCGCTACCGGTGGCGTGGAAGCGGCCCGTCTTTGCCTTTGTCTTCCTGTGTTGG
AGAGCAGCTTATAACATTGGCATTGGCATCTTGCTCCATGTCCAGTCGCACCACGGCCGCCTCATTACTTGGGCT
CGTCGCTGGAAGCTCTTTGAGGACCCCAAGTCGAGCGACAATCCGCGGCCATGGCTCTACAGGCTTATCAAACGC
GAGCTCGAAGCCAAGATACCGCAAGACTACCAGCTGGAACTGGCACCTATAGAATACAACACGTGGCTCGTCTTC
CGCCGCGTTGTTGACCTCATTCTCATGTGCGACTTTGTCTCGTACTGCCTCTTTGCCATTGTTTGCGGCCAGACG
CCCAGGGGTGAGCGCCTCGTCATGACGGCGATGCGATGGTCGCTCGGCCTCGTTCTCGTCGGCTTCAACATTTGG
GTCAAGCTAGACGCGCATCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGAGACTTTTTCTACCTCATTGACCAG
GACCTGACGTTTGACGGCGTCTTTGAGCTGGCGCCACATCCAATGTATTCAATTGGCTATGCCGGCTACTACGGC
ATCTCCATGATGGCGGCCAGCTACGAGGTGCTCTTCATCTCCATCGTGGCACACGTTGCTCAGTTTGCCTTTCTC
CTGACGGTGGAAAACCCGCACATTGAAAAGACGTACAATCCGCCGCCGCCGCGGGTTCGTATCCTCACCGACAGC
CGCGGCGAGCCTGGGTCGCAGGCCGACGCAGCCGACGAGGAATGCGTCACGGCTTCGCTATCGTCACGCTCCTTT
CATCCGTCGGAGTCGCCGGCAGCGGTTCATGACATGGTTGGCTTGGGCAGCATTGACCTGTTCCGGCTCCCCGAC
TGCGTTGTCTTCCTCATGCCCTTTTACGTGGCCCTTGTCACTCTTGCGACGCCCTCGACACCACCGTGGCAGGCT
GCCTTTATTGTGCATGCCTTGGTCTGGCGCATCTGGTACCATCTTGGCCTTGGAATCATCCTGGACCAGCAGTCC
AAGGCCAAGATGTGGACTCGCCATTTCCTTAAATTTGGCGAGGGCGCAAACGAAGCTTGGAGGCAGTGGAAGGCC
ATGATGCACGTCAGCATGATTATGTGCAACACAGCCCTGATTGCGTCGTGCTGGAAAATGTATGCGCCCCCACAG
GCCTGGGTGTCGGGCCTGGCACTCTTACGGCACATTGTTGGCGCTTCCTTGATCGCGCTTCAGCTTTGGACAGCT
GTCAGCGTGTACAACTCGCTTGGCGAGTTTGGCTGGTTCTGCGGCGACTTTTTTTTCGATCATGGAGTCAAACTA
ACATATACGTCGATTTACCGCTTCCTCAATAACCCTGAGAGAATCTTTGGAACGGCAGGTGTATGGGGCGCGGCT
CTCATTACGTGGAGCAGATTCATCTTTATTATGGCTATTGTGACTCAGTTTATGTCTCTGTACTATCTCTCCTTT
ATTGAGCGGCCACACATGCAGAAGATCTATGGCCGCAGTCTGCGCGAGGAAGCCGGGCTCACCAAGTTTTTGAAG
CGATCGCTGCCGCCACCCGTCAAGGGATGGCAGCAGAGCATGGACAAGGTTGTCGACGACACGAGCCACTTTGTC
GCCGACTTTATTGAATTTGCTAGACCCAAGTTTGCGTCTGGCGTCAAGACGATAGTGCGCGACACATCGGCCCTC
TTCAACGTTGCTCCGGCACGGCTCACGATAACAAGGATCACGCCAGGAGTGGCTGGGTTGGATTCCAAGCACTAC
TCACTTGTGGTACAAGGCACGGCGTCGGCTCCATCGTCGAGTAGGGATCGTTCAACGGGCAAGGAGAGCATTAGG
GGTAGATTTCCCAAGGGCATCAAGACCATGTCGTACGAGTACGGCACCCCGCTCAAGGTCAAGTGGCGGGCTCCT
GCAGGGCACAGTGAGCAAGATTGGATTGGCCTTTACATGGTGACGGACAATCGGTCGAGAGATAGCACAGAGGTT
TCATCGCTGGGCCGCTGGGCACCCACCAACTCGGGCGTTTACGACGCACTTACAGCCGACAGCAGCATTGTCAAG
GACGAGCAGCCTGTGGCGGCAGACGATGGAGTGAGCCCCCGGCTAGTGGAGGGCGAGGTTGTTTTCGAGGGTGAC
AGGCTCTGGTGGACACAGGGTGTGTTTGAGTTTCGCTACCACCACGACGGCAATCACAACGCCATGACGATTTCG
GAGCCGTTTGAAATTGGCATTTCACCATTTGTCGACAGCGAGAGCGAGGCAGAAGGCCTGCCCGAAGGCAAGACG
GCCTACTCGCGGGCTGTTGAGGCAGCCATGCTCCCGGTGGTGCGCAACTGCCTGGATCGCGACCCAGACATTGCG
CCAAGCACAGTGGAGGAGCTCTTTGGCAGCCATGTGGAACGCGATGCCAAGTATTCGCGACGAATCGTGTATGCC
ATTCGAGAAATCTTTGGCATTGAATTTGCACCGGCTGTGGTGCTTGCCGACGGCAATGTGAGGAAGCTTGCGTGG
AGAATATGCAATGCCAAGGCTGTCTTGGCTCCGTTTAGCATGTCGCCTTCGCGAGGCACAGCGACCCCGGCACGG
CGCGACTTTGAGCATGAGGAAGCCAGCTCGTGA
Transcript >OphauB2|1264
ATGGAAGCTGCACTTGACAGGCCTGTTGGCCAATCTGAGTTGCGCAGGCGGCACTCTCGCAATGGCACGAAGCAG
CAGACCGAGGCCAAGGGCAACAAGACTTTTGGCCGAACCGCCGACGGCACAATCTTTGTGGTACCAGCGACCCAT
GACATGGTCTCGCAGTTGCTAGACCCTCGCCAGCCAAAGAACCTGTCAGACGCCTTGGTCCTGGCCATTCTAGTC
CTGCACATCTTTGCTGCTTATTCGCTACCGGTGGCGTGGAAGCGGCCCGTCTTTGCCTTTGTCTTCCTGTGTTGG
AGAGCAGCTTATAACATTGGCATTGGCATCTTGCTCCATGTCCAGTCGCACCACGGCCGCCTCATTACTTGGGCT
CGTCGCTGGAAGCTCTTTGAGGACCCCAAGTCGAGCGACAATCCGCGGCCATGGCTCTACAGGCTTATCAAACGC
GAGCTCGAAGCCAAGATACCGCAAGACTACCAGCTGGAACTGGCACCTATAGAATACAACACGTGGCTCGTCTTC
CGCCGCGTTGTTGACCTCATTCTCATGTGCGACTTTGTCTCGTACTGCCTCTTTGCCATTGTTTGCGGCCAGACG
CCCAGGGGTGAGCGCCTCGTCATGACGGCGATGCGATGGTCGCTCGGCCTCGTTCTCGTCGGCTTCAACATTTGG
GTCAAGCTAGACGCGCATCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGAGACTTTTTCTACCTCATTGACCAG
GACCTGACGTTTGACGGCGTCTTTGAGCTGGCGCCACATCCAATGTATTCAATTGGCTATGCCGGCTACTACGGC
ATCTCCATGATGGCGGCCAGCTACGAGGTGCTCTTCATCTCCATCGTGGCACACGTTGCTCAGTTTGCCTTTCTC
CTGACGGTGGAAAACCCGCACATTGAAAAGACGTACAATCCGCCGCCGCCGCGGGTTCGTATCCTCACCGACAGC
CGCGGCGAGCCTGGGTCGCAGGCCGACGCAGCCGACGAGGAATGCGTCACGGCTTCGCTATCGTCACGCTCCTTT
CATCCGTCGGAGTCGCCGGCAGCGGTTCATGACATGGTTGGCTTGGGCAGCATTGACCTGTTCCGGCTCCCCGAC
TGCGTTGTCTTCCTCATGCCCTTTTACGTGGCCCTTGTCACTCTTGCGACGCCCTCGACACCACCGTGGCAGGCT
GCCTTTATTGTGCATGCCTTGGTCTGGCGCATCTGGTACCATCTTGGCCTTGGAATCATCCTGGACCAGCAGTCC
AAGGCCAAGATGTGGACTCGCCATTTCCTTAAATTTGGCGAGGGCGCAAACGAAGCTTGGAGGCAGTGGAAGGCC
ATGATGCACGTCAGCATGATTATGTGCAACACAGCCCTGATTGCGTCGTGCTGGAAAATGTATGCGCCCCCACAG
GCCTGGGTGTCGGGCCTGGCACTCTTACGGCACATTGTTGGCGCTTCCTTGATCGCGCTTCAGCTTTGGACAGCT
GTCAGCGTGTACAACTCGCTTGGCGAGTTTGGCTGGTTCTGCGGCGACTTTTTTTTCGATCATGGAGTCAAACTA
ACATATACGTCGATTTACCGCTTCCTCAATAACCCTGAGAGAATCTTTGGAACGGCAGGTGTATGGGGCGCGGCT
CTCATTACGTGGAGCAGATTCATCTTTATTATGGCTATTGTGACTCAGTTTATGTCTCTGTACTATCTCTCCTTT
ATTGAGCGGCCACACATGCAGAAGATCTATGGCCGCAGTCTGCGCGAGGAAGCCGGGCTCACCAAGTTTTTGAAG
CGATCGCTGCCGCCACCCGTCAAGGGATGGCAGCAGAGCATGGACAAGGTTGTCGACGACACGAGCCACTTTGTC
GCCGACTTTATTGAATTTGCTAGACCCAAGTTTGCGTCTGGCGTCAAGACGATAGTGCGCGACACATCGGCCCTC
TTCAACGTTGCTCCGGCACGGCTCACGATAACAAGGATCACGCCAGGAGTGGCTGGGTTGGATTCCAAGCACTAC
TCACTTGTGGTACAAGGCACGGCGTCGGCTCCATCGTCGAGTAGGGATCGTTCAACGGGCAAGGAGAGCATTAGG
GGTAGATTTCCCAAGGGCATCAAGACCATGTCGTACGAGTACGGCACCCCGCTCAAGGTCAAGTGGCGGGCTCCT
GCAGGGCACAGTGAGCAAGATTGGATTGGCCTTTACATGGTGACGGACAATCGGTCGAGAGATAGCACAGAGGTT
TCATCGCTGGGCCGCTGGGCACCCACCAACTCGGGCGTTTACGACGCACTTACAGCCGACAGCAGCATTGTCAAG
GACGAGCAGCCTGTGGCGGCAGACGATGGAGTGAGCCCCCGGCTAGTGGAGGGCGAGGTTGTTTTCGAGGGTGAC
AGGCTCTGGTGGACACAGGGTGTGTTTGAGTTTCGCTACCACCACGACGGCAATCACAACGCCATGACGATTTCG
GAGCCGTTTGAAATTGGCATTTCACCATTTGTCGACAGCGAGAGCGAGGCAGAAGGCCTGCCCGAAGGCAAGACG
GCCTACTCGCGGGCTGTTGAGGCAGCCATGCTCCCGGTGGTGCGCAACTGCCTGGATCGCGACCCAGACATTGCG
CCAAGCACAGTGGAGGAGCTCTTTGGCAGCCATGTGGAACGCGATGCCAAGTATTCGCGACGAATCGTGTATGCC
ATTCGAGAAATCTTTGGCATTGAATTTGCACCGGCTGTGGTGCTTGCCGACGGCAATGTGAGGAAGCTTGCGTGG
AGAATATGCAATGCCAAGGCTGTCTTGGCTCCGTTTAGCATGTCGCCTTCGCGAGGCACAGCGACCCCGGCACGG
CGCGACTTTGAGCATGAGGAAGCCAGCTCGTGA
Gene >OphauB2|1264
ATGGAAGCTGCACTTGACAGGCCTGTTGGCCAATCTGAGTTGCGCAGGCGGCACTCTCGCAATGGCACGAAGCAG
CAGACCGAGGCCAAGGGCAACAAGACTTTTGGCCGAACCGCCGACGGCACAAGTTGGTTCATTAAAACGGTTATG
GGATAAATGTGCATGGCTGACCTAGTTTTTCGTTGCCCAAAGTCTTTGTGGTACCAGCGACCCATGACATGGTCT
CGCAGTTGCTAGACCCTCGCCAGCCAAAGAACCTGTCAGACGCCTTGGTCCTGGCCATTCTAGTCCTGCACATCT
TTGCTGCTTATTCGCTACCGGTGGCGTGGAAGCGGCCCGTCTTTGCCTTTGTCTTCCTGTGTTGGAGAGCAGCTT
ATAACATTGGCATTGGCATCTTGCTCCATGTCCAGTCGCACCACGGCCGCCTCATTACTTGGGCTCGTCGCTGGA
AGCTCTTTGAGGACCCCAAGTCGAGCGACAATCCGCGGCCATGGCTCTACAGGCTTATCAAACGCGAGCTCGAAG
CCAAGATACCGCAAGACTACCAGCTGGAACTGGCACCTATAGAATACAACACGTGGCTCGTCTTCCGCCGCGTTG
TTGACCTCATTCTCATGTGCGACTTTGTCTCGTACTGCCTCTTTGCCATTGTTTGCGGCCAGACGCCCAGGGGTG
AGCGCCTCGTCATGACGGCGATGCGATGGTCGCTCGGCCTCGTTCTCGTCGGCTTCAACATTTGGGTCAAGCTAG
ACGCGCATCGGGTCGTCAAGGACTTTGCCTGGTACTGGGGAGACTTTTTCTACCTCATTGACCAGGACCTGACGT
TTGACGGCGTCTTTGAGCTGGCGCCACATCCAATGTATTCAATTGGCTATGCCGGCTACTACGGCATCTCCATGA
TGGCGGCCAGCTACGAGGTGCTCTTCATCTCCATCGTGGCACACGTTGCTCAGTTTGCCTTTCTCCTGACGGTGG
AAAACCCGCACATTGAAAAGACGTACAATCCGCCGCCGCCGCGGGTTCGTATCCTCACCGACAGCCGCGGCGAGC
CTGGGTCGCAGGCCGACGCAGCCGACGAGGAATGCGTCACGGCTTCGCTATCGTCACGCTCCTTTCATCCGTCGG
AGTCGCCGGCAGCGGTTCATGACATGGTTGGCTTGGGCAGCATTGACCTGTTCCGGCTCCCCGACTGCGTTGTCT
TCCTCATGCCCTTTTACGTGGCCCTTGTCACTCTTGCGACGCCCTCGACACCACCGTGGCAGGCTGCCTTTATTG
TGCATGCCTTGGTCTGGCGCATCTGGTACCATCTTGGCCTTGGAATCATCCTGGACCAGCAGTCCAAGGCCAAGA
TGTGGACTCGCCATTTCCTTAAATTTGGCGAGGGCGCAAACGAAGCTTGGAGGCAGTGGAAGGCCATGATGCACG
TCAGCATGATTATGTGCAACACAGCCCTGATTGCGTCGTGCTGGAAAATGTATGCGCCCCCACAGGCCTGGGTGT
CGGGCCTGGCACTCTTACGGCACATTGTTGGCGCTTCCTTGATCGCGCTTCAGCTTTGGACAGCTGTCAGCGTGT
ACAACTCGCTTGGCGAGTTTGGCTGGTTCTGCGGCGACTTTTTTTTCGATCATGGAGTCAAACTAACATATACGT
CGATTTACCGCTTCCTCAATAACCCTGAGAGAATCTTTGGAACGGCAGGTGTATGGGGCGCGGCTCTCATTACGT
GGAGCAGATTCATCTTTATTATGGCTATTGTGACTCAGTTTATGTCTCTGTACTATCTCTCCTTTATTGAGCGGC
CACACATGCAGAAGATCTATGGCCGCAGTCTGCGCGAGGAAGCCGGGCTCACCAAGTTTTTGAAGCGATCGCTGC
CGCCACCCGTCAAGGGATGGCAGCAGAGCATGGACAAGGTTGTCGACGACACGAGCCACTTTGTCGCCGACTTTA
TTGAATTTGCTAGACCCAAGTTTGCGTCTGGCGTCAAGACGATAGTGCGCGACACATCGGCCCTCTTCAACGTTG
CTCCGGCACGGCTCACGATAACAAGGATCACGCCAGGAGTGGCTGGGTTGGATTCCAAGCACTACTCACTTGTGG
TACAAGGCACGGCGTCGGCTCCATCGTCGAGTAGGGATCGTTCAACGGGCAAGGAGAGCATTAGGGGTAGATTTC
CCAAGGGCATCAAGACCATGTCGTACGAGTACGGCACCCCGCTCAAGGTCAAGTGGCGGGCTCCTGCAGGGCACA
GTGAGCAAGATTGGATTGGCCTTTACATGGTGACGGACAATCGGTCGAGAGATAGCACAGAGGTTTCATCGCTGG
GCCGCTGGGCACCCACCAACTCGGGCGTTTACGACGCACTTACAGCCGACAGCAGCATTGTCAAGGACGAGCAGC
CTGTGGCGGCAGACGATGGAGTGAGCCCCCGGCTAGTGGAGGGCGAGGTTGTTTTCGAGGGTGACAGGCTCTGGT
GGACACAGGGTGTGTTTGAGTTTCGCTACCACCACGACGGCAATCACAACGCCATGACGATTTCGGAGCCGTTTG
AAATTGGCATTTCACCATTTGTCGACAGCGAGAGCGAGGCAGAAGGCCTGCCCGAAGGCAAGACGGCCTACTCGC
GGGCTGTTGAGGCAGCCATGCTCCCGGTGGTGCGCAACTGCCTGGATCGCGACCCAGACATTGCGCCAAGCACAG
TGGAGGAGCTCTTTGGCAGCCATGTGGAACGCGATGCCAAGTATTCGCGACGAATCGTGTATGCCATTCGAGAAA
TCTTTGGCATTGAATTTGCACCGGCTGTGGTGCTTGCCGACGGCAATGTGAGGAAGCTTGCGTGGAGAATATGCA
ATGCCAAGGCTGTCTTGGTAGGAGACGACTCAGAATTGATTCATGGCGTCAAGAGGCTAATGTATGTGATTGCAG
GCTCCGTTTAGCATGTCGCCTTCGCGAGGCACAGCGACCCCGGCACGGCGCGACTTTGAGCATGAGGAAGCCAGC
TCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail