Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1262
Gene name
LocationContig_13:222153..225507
Strand+
Gene length (bp)3354
Transcript length (bp)3354
Coding sequence length (bp)3354
Protein length (aa) 1118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 1.7E-04 258 291
PF05057 DUF676 Putative serine esterase (DUF676) 2.0E-27 458 605

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04093|YD444_YEAST Putative lipase YDR444W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR444W PE=1 SV=1 418 986 1.0E-60
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 458 626 5.0E-30
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 461 616 1.0E-29
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 793 958 1.0E-25
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 461 622 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04093|YD444_YEAST Putative lipase YDR444W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR444W PE=1 SV=1 418 986 1.0E-60
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 458 626 5.0E-30
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 461 616 1.0E-29
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 793 958 1.0E-25
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 461 622 9.0E-23
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 796 997 3.0E-21
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 2 375 1.0E-20
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 907 958 9.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1262
MLLVHQVGSLKIGEVVRYTVSYTPSQDRILPSPERLHVRIRNTSTIALRAAFVHGPYTLSVAAYPAGFSPNEKFA
NPRRYGVPEFEPMLKAGGSWECELTVPDTIRQSAGTGAGGQVFGKGPEHDDESASWIIELSSQVIFSTSAAVGYE
LVVARDPKSLTLTQSLPIVSGGQSKVPQPGKVGDLQQQASFKDGRHVAQPRGVFSRAVHVAVEDTATLWNKPQLP
MADEIKEKMELQAQGGSGDRDEARGREKTRKKRKKVHLVLLTHGLHSNLSADMLFIKESIDVAARQARVDAKTRV
RRQREQQKPGTQSSDATAEAHGGDADVDATKQGDEDDEDYEHVVVRGYPGNATKTERGIKYLGKRLARYVLSMTY
PDQPFFPIGKGVVEGFKETAGVETDDGKHHDHGMSHHGSQHNGHGDKEGNGAHDHVKQVHKHSTIQADMDTERRH
GQQRPYQITSISFVGHSLGGLVQTYAVAYIQKHSPQFFDVIKPINFIALASPFLGLSNENPLYVKFALDFGLVGR
TGQDLGLTWRAPTIARSGWGALVGNLGESAHKKVYGEMQPESKPLLRILPTGPAHAALNKFRNRTVYSNVVNDGI
VPLRTSCLLFLDWQGLGRVEKARRDAGLVETVVGFGWAELMGTNMTSPRSKHPPSGDGRRADEAMREVPQPPNEA
MDEDDGASIKSMPEGFSEDAAAAAAAPVSANEPNHSGALSTFLNLFKSNESPKEHAKEHAKEHIKEQAKEHAMSQ
KQKKILRRGQTMPLDQAAAGKQQTKVTSGHELEGQDQAMTAPPKTTFFESAGDVLNPSMPSTEYIIDPTKRPRSI
FHDRVYHPSDIPPPPLKKRQTSSLSRRKTFHKGNSTGSTSSGPYSTGKTGESSWVRDYDDTAHTKADKKADEVVD
GSSMRVEEKIARGYHRDLSWRKVLVKLEPDAHNNIVVRRMFANAYGWPVIKHLVDAHFSDLASARMRDEDEDSAE
GALDMNQPPDEHGGETKGQVASLPSSPSSSGGHGKPENAAAATSDAVTRTVSEAREALDQVGHLPSWSLQDGQDG
RASSRADSVTWSERDWSDSGNESELDTGVGGKDLSKQEQPSLSPRPWNWTEKIVGKGAASNRSKSPR*
Coding >OphauB2|1262
ATGCTGCTGGTGCACCAGGTCGGCAGCCTCAAGATTGGCGAGGTTGTACGCTACACGGTCAGCTATACGCCTTCG
CAGGACCGCATCCTGCCCTCGCCTGAGCGACTGCACGTCCGTATCCGCAACACGTCGACGATTGCTCTTCGAGCC
GCCTTTGTCCACGGTCCGTATACACTTTCAGTCGCGGCCTATCCGGCGGGGTTTTCTCCCAACGAAAAGTTTGCC
AATCCGCGTCGATATGGCGTCCCCGAGTTTGAGCCCATGCTCAAGGCCGGCGGCTCGTGGGAATGCGAGCTGACG
GTGCCTGACACGATACGGCAGAGCGCAGGAACTGGAGCTGGCGGCCAAGTCTTTGGCAAGGGACCCGAGCATGAT
GATGAAAGTGCGAGCTGGATCATTGAGCTGTCCTCCCAGGTCATCTTTTCTACGTCGGCAGCCGTCGGGTACGAG
CTAGTGGTTGCGCGCGACCCAAAGTCGCTGACACTGACCCAGTCTCTGCCCATTGTCTCTGGAGGTCAAAGCAAG
GTGCCTCAGCCGGGCAAGGTGGGCGATTTGCAGCAGCAGGCAAGCTTCAAGGACGGCCGCCATGTTGCACAGCCT
CGCGGCGTCTTTTCTCGGGCGGTGCATGTGGCGGTTGAAGACACTGCCACGCTGTGGAACAAGCCGCAACTACCC
ATGGCTGACGAAATCAAGGAGAAAATGGAGCTGCAAGCGCAGGGCGGCTCCGGCGACAGAGACGAAGCCAGGGGG
AGGGAAAAAACTAGGAAGAAGCGGAAAAAGGTGCACCTGGTTCTGCTGACGCACGGTCTGCACAGTAATCTCAGC
GCCGATATGCTCTTCATCAAGGAAAGCATCGACGTGGCTGCTCGGCAAGCCAGAGTCGATGCGAAGACGAGAGTG
AGAAGACAGCGAGAGCAGCAAAAGCCTGGGACACAGAGCAGTGACGCCACGGCGGAGGCACATGGCGGTGACGCC
GACGTGGATGCCACCAAGCAAGGCGATGAAGACGATGAAGACTACGAGCATGTCGTGGTGCGAGGATATCCCGGA
AATGCCACAAAGACGGAAAGGGGTATCAAGTATCTAGGCAAGAGACTGGCAAGATATGTGCTCTCCATGACATAC
CCAGACCAGCCATTCTTCCCAATTGGAAAAGGCGTCGTGGAAGGATTCAAGGAGACGGCTGGCGTGGAGACGGAT
GACGGCAAGCATCACGACCATGGCATGAGTCACCATGGCAGTCAGCATAATGGCCACGGTGATAAGGAGGGCAAT
GGCGCTCATGACCACGTCAAGCAGGTGCACAAGCACAGCACGATACAGGCAGACATGGACACGGAGCGGCGACAT
GGGCAGCAACGGCCGTACCAAATCACGAGCATCAGCTTCGTGGGACACTCGCTGGGCGGCTTGGTGCAGACTTAT
GCCGTTGCCTACATCCAGAAACACTCGCCGCAGTTTTTCGACGTGATCAAACCAATCAACTTTATAGCCCTGGCC
TCGCCCTTTCTTGGGCTGAGCAACGAGAACCCGCTCTATGTAAAGTTTGCTCTAGACTTTGGCCTGGTGGGCAGG
ACAGGGCAGGACTTGGGTTTGACTTGGCGGGCTCCGACTATTGCTCGCAGCGGATGGGGCGCCCTTGTTGGCAAC
CTGGGCGAGTCGGCGCACAAGAAGGTGTATGGCGAGATGCAGCCCGAGTCGAAGCCGCTGCTGCGCATTCTGCCC
ACGGGCCCGGCCCACGCGGCGCTCAACAAGTTTCGAAACCGCACCGTCTACTCCAACGTGGTGAATGACGGCATC
GTGCCGCTGCGAACCAGCTGTCTGCTCTTCCTCGACTGGCAGGGGCTTGGGCGCGTGGAAAAGGCACGCAGAGAC
GCGGGGCTGGTTGAGACGGTGGTTGGCTTTGGCTGGGCCGAGCTCATGGGCACCAACATGACGAGTCCTCGCAGC
AAGCACCCGCCCTCGGGCGACGGGCGGCGGGCTGACGAAGCAATGCGCGAGGTGCCTCAGCCGCCCAACGAGGCC
ATGGATGAAGACGACGGAGCCAGCATCAAGTCGATGCCCGAAGGATTCTCGGAAGATGCGGCGGCAGCAGCAGCG
GCCCCGGTCAGCGCCAACGAGCCCAACCACTCTGGAGCTCTGTCCACCTTTCTCAATCTCTTCAAGAGCAACGAG
TCTCCCAAGGAGCATGCCAAGGAGCATGCCAAGGAGCATATCAAGGAGCAGGCCAAGGAGCACGCCATGTCACAG
AAGCAAAAAAAGATTTTGCGGCGGGGCCAGACGATGCCGCTCGACCAAGCAGCTGCTGGCAAGCAGCAGACCAAG
GTGACGTCGGGCCACGAGCTCGAGGGCCAGGACCAGGCCATGACGGCTCCCCCCAAGACGACCTTTTTCGAATCG
GCGGGCGATGTGCTGAATCCAAGCATGCCCAGCACCGAATACATTATCGATCCTACCAAGCGGCCACGAAGCATC
TTCCACGACCGCGTCTATCACCCCAGCGACATTCCACCTCCGCCGCTCAAGAAGCGACAGACGAGCAGCCTGAGC
CGGCGTAAGACGTTTCACAAAGGCAACTCGACGGGCAGCACCTCTTCAGGGCCATATAGCACAGGCAAGACGGGC
GAGTCATCATGGGTCAGGGACTATGACGACACGGCGCATACAAAAGCAGACAAGAAAGCAGACGAGGTGGTGGAC
GGCTCGAGCATGCGCGTCGAGGAAAAGATTGCCCGAGGCTACCATCGCGACTTGTCGTGGCGCAAAGTCTTGGTC
AAGCTGGAGCCGGATGCGCACAACAACATTGTAGTGAGACGCATGTTTGCCAATGCCTACGGCTGGCCCGTAATC
AAGCACCTGGTGGACGCGCATTTTAGCGACTTGGCCAGTGCGCGAATGCGTGACGAGGACGAGGACTCGGCTGAA
GGCGCACTCGACATGAACCAGCCACCCGACGAGCACGGCGGTGAGACAAAGGGCCAAGTGGCGTCGCTGCCCTCG
TCGCCCAGCTCGTCAGGCGGCCACGGCAAGCCCGAAAATGCCGCAGCAGCCACCTCGGATGCCGTGACGCGCACC
GTCAGCGAGGCACGCGAGGCCCTCGATCAGGTGGGCCACCTGCCGTCTTGGTCGCTCCAAGATGGCCAAGACGGA
CGAGCATCAAGTAGGGCCGACTCGGTGACTTGGAGCGAGCGCGACTGGAGCGACAGCGGCAACGAGAGCGAGCTG
GACACGGGCGTTGGGGGCAAAGACTTGAGCAAACAAGAACAGCCAAGCCTGAGCCCAAGGCCGTGGAACTGGACG
GAAAAAATTGTAGGCAAGGGCGCGGCGTCGAACCGTAGCAAGAGCCCCAGGTAA
Transcript >OphauB2|1262
ATGCTGCTGGTGCACCAGGTCGGCAGCCTCAAGATTGGCGAGGTTGTACGCTACACGGTCAGCTATACGCCTTCG
CAGGACCGCATCCTGCCCTCGCCTGAGCGACTGCACGTCCGTATCCGCAACACGTCGACGATTGCTCTTCGAGCC
GCCTTTGTCCACGGTCCGTATACACTTTCAGTCGCGGCCTATCCGGCGGGGTTTTCTCCCAACGAAAAGTTTGCC
AATCCGCGTCGATATGGCGTCCCCGAGTTTGAGCCCATGCTCAAGGCCGGCGGCTCGTGGGAATGCGAGCTGACG
GTGCCTGACACGATACGGCAGAGCGCAGGAACTGGAGCTGGCGGCCAAGTCTTTGGCAAGGGACCCGAGCATGAT
GATGAAAGTGCGAGCTGGATCATTGAGCTGTCCTCCCAGGTCATCTTTTCTACGTCGGCAGCCGTCGGGTACGAG
CTAGTGGTTGCGCGCGACCCAAAGTCGCTGACACTGACCCAGTCTCTGCCCATTGTCTCTGGAGGTCAAAGCAAG
GTGCCTCAGCCGGGCAAGGTGGGCGATTTGCAGCAGCAGGCAAGCTTCAAGGACGGCCGCCATGTTGCACAGCCT
CGCGGCGTCTTTTCTCGGGCGGTGCATGTGGCGGTTGAAGACACTGCCACGCTGTGGAACAAGCCGCAACTACCC
ATGGCTGACGAAATCAAGGAGAAAATGGAGCTGCAAGCGCAGGGCGGCTCCGGCGACAGAGACGAAGCCAGGGGG
AGGGAAAAAACTAGGAAGAAGCGGAAAAAGGTGCACCTGGTTCTGCTGACGCACGGTCTGCACAGTAATCTCAGC
GCCGATATGCTCTTCATCAAGGAAAGCATCGACGTGGCTGCTCGGCAAGCCAGAGTCGATGCGAAGACGAGAGTG
AGAAGACAGCGAGAGCAGCAAAAGCCTGGGACACAGAGCAGTGACGCCACGGCGGAGGCACATGGCGGTGACGCC
GACGTGGATGCCACCAAGCAAGGCGATGAAGACGATGAAGACTACGAGCATGTCGTGGTGCGAGGATATCCCGGA
AATGCCACAAAGACGGAAAGGGGTATCAAGTATCTAGGCAAGAGACTGGCAAGATATGTGCTCTCCATGACATAC
CCAGACCAGCCATTCTTCCCAATTGGAAAAGGCGTCGTGGAAGGATTCAAGGAGACGGCTGGCGTGGAGACGGAT
GACGGCAAGCATCACGACCATGGCATGAGTCACCATGGCAGTCAGCATAATGGCCACGGTGATAAGGAGGGCAAT
GGCGCTCATGACCACGTCAAGCAGGTGCACAAGCACAGCACGATACAGGCAGACATGGACACGGAGCGGCGACAT
GGGCAGCAACGGCCGTACCAAATCACGAGCATCAGCTTCGTGGGACACTCGCTGGGCGGCTTGGTGCAGACTTAT
GCCGTTGCCTACATCCAGAAACACTCGCCGCAGTTTTTCGACGTGATCAAACCAATCAACTTTATAGCCCTGGCC
TCGCCCTTTCTTGGGCTGAGCAACGAGAACCCGCTCTATGTAAAGTTTGCTCTAGACTTTGGCCTGGTGGGCAGG
ACAGGGCAGGACTTGGGTTTGACTTGGCGGGCTCCGACTATTGCTCGCAGCGGATGGGGCGCCCTTGTTGGCAAC
CTGGGCGAGTCGGCGCACAAGAAGGTGTATGGCGAGATGCAGCCCGAGTCGAAGCCGCTGCTGCGCATTCTGCCC
ACGGGCCCGGCCCACGCGGCGCTCAACAAGTTTCGAAACCGCACCGTCTACTCCAACGTGGTGAATGACGGCATC
GTGCCGCTGCGAACCAGCTGTCTGCTCTTCCTCGACTGGCAGGGGCTTGGGCGCGTGGAAAAGGCACGCAGAGAC
GCGGGGCTGGTTGAGACGGTGGTTGGCTTTGGCTGGGCCGAGCTCATGGGCACCAACATGACGAGTCCTCGCAGC
AAGCACCCGCCCTCGGGCGACGGGCGGCGGGCTGACGAAGCAATGCGCGAGGTGCCTCAGCCGCCCAACGAGGCC
ATGGATGAAGACGACGGAGCCAGCATCAAGTCGATGCCCGAAGGATTCTCGGAAGATGCGGCGGCAGCAGCAGCG
GCCCCGGTCAGCGCCAACGAGCCCAACCACTCTGGAGCTCTGTCCACCTTTCTCAATCTCTTCAAGAGCAACGAG
TCTCCCAAGGAGCATGCCAAGGAGCATGCCAAGGAGCATATCAAGGAGCAGGCCAAGGAGCACGCCATGTCACAG
AAGCAAAAAAAGATTTTGCGGCGGGGCCAGACGATGCCGCTCGACCAAGCAGCTGCTGGCAAGCAGCAGACCAAG
GTGACGTCGGGCCACGAGCTCGAGGGCCAGGACCAGGCCATGACGGCTCCCCCCAAGACGACCTTTTTCGAATCG
GCGGGCGATGTGCTGAATCCAAGCATGCCCAGCACCGAATACATTATCGATCCTACCAAGCGGCCACGAAGCATC
TTCCACGACCGCGTCTATCACCCCAGCGACATTCCACCTCCGCCGCTCAAGAAGCGACAGACGAGCAGCCTGAGC
CGGCGTAAGACGTTTCACAAAGGCAACTCGACGGGCAGCACCTCTTCAGGGCCATATAGCACAGGCAAGACGGGC
GAGTCATCATGGGTCAGGGACTATGACGACACGGCGCATACAAAAGCAGACAAGAAAGCAGACGAGGTGGTGGAC
GGCTCGAGCATGCGCGTCGAGGAAAAGATTGCCCGAGGCTACCATCGCGACTTGTCGTGGCGCAAAGTCTTGGTC
AAGCTGGAGCCGGATGCGCACAACAACATTGTAGTGAGACGCATGTTTGCCAATGCCTACGGCTGGCCCGTAATC
AAGCACCTGGTGGACGCGCATTTTAGCGACTTGGCCAGTGCGCGAATGCGTGACGAGGACGAGGACTCGGCTGAA
GGCGCACTCGACATGAACCAGCCACCCGACGAGCACGGCGGTGAGACAAAGGGCCAAGTGGCGTCGCTGCCCTCG
TCGCCCAGCTCGTCAGGCGGCCACGGCAAGCCCGAAAATGCCGCAGCAGCCACCTCGGATGCCGTGACGCGCACC
GTCAGCGAGGCACGCGAGGCCCTCGATCAGGTGGGCCACCTGCCGTCTTGGTCGCTCCAAGATGGCCAAGACGGA
CGAGCATCAAGTAGGGCCGACTCGGTGACTTGGAGCGAGCGCGACTGGAGCGACAGCGGCAACGAGAGCGAGCTG
GACACGGGCGTTGGGGGCAAAGACTTGAGCAAACAAGAACAGCCAAGCCTGAGCCCAAGGCCGTGGAACTGGACG
GAAAAAATTGTAGGCAAGGGCGCGGCGTCGAACCGTAGCAAGAGCCCCAGGTAA
Gene >OphauB2|1262
ATGCTGCTGGTGCACCAGGTCGGCAGCCTCAAGATTGGCGAGGTTGTACGCTACACGGTCAGCTATACGCCTTCG
CAGGACCGCATCCTGCCCTCGCCTGAGCGACTGCACGTCCGTATCCGCAACACGTCGACGATTGCTCTTCGAGCC
GCCTTTGTCCACGGTCCGTATACACTTTCAGTCGCGGCCTATCCGGCGGGGTTTTCTCCCAACGAAAAGTTTGCC
AATCCGCGTCGATATGGCGTCCCCGAGTTTGAGCCCATGCTCAAGGCCGGCGGCTCGTGGGAATGCGAGCTGACG
GTGCCTGACACGATACGGCAGAGCGCAGGAACTGGAGCTGGCGGCCAAGTCTTTGGCAAGGGACCCGAGCATGAT
GATGAAAGTGCGAGCTGGATCATTGAGCTGTCCTCCCAGGTCATCTTTTCTACGTCGGCAGCCGTCGGGTACGAG
CTAGTGGTTGCGCGCGACCCAAAGTCGCTGACACTGACCCAGTCTCTGCCCATTGTCTCTGGAGGTCAAAGCAAG
GTGCCTCAGCCGGGCAAGGTGGGCGATTTGCAGCAGCAGGCAAGCTTCAAGGACGGCCGCCATGTTGCACAGCCT
CGCGGCGTCTTTTCTCGGGCGGTGCATGTGGCGGTTGAAGACACTGCCACGCTGTGGAACAAGCCGCAACTACCC
ATGGCTGACGAAATCAAGGAGAAAATGGAGCTGCAAGCGCAGGGCGGCTCCGGCGACAGAGACGAAGCCAGGGGG
AGGGAAAAAACTAGGAAGAAGCGGAAAAAGGTGCACCTGGTTCTGCTGACGCACGGTCTGCACAGTAATCTCAGC
GCCGATATGCTCTTCATCAAGGAAAGCATCGACGTGGCTGCTCGGCAAGCCAGAGTCGATGCGAAGACGAGAGTG
AGAAGACAGCGAGAGCAGCAAAAGCCTGGGACACAGAGCAGTGACGCCACGGCGGAGGCACATGGCGGTGACGCC
GACGTGGATGCCACCAAGCAAGGCGATGAAGACGATGAAGACTACGAGCATGTCGTGGTGCGAGGATATCCCGGA
AATGCCACAAAGACGGAAAGGGGTATCAAGTATCTAGGCAAGAGACTGGCAAGATATGTGCTCTCCATGACATAC
CCAGACCAGCCATTCTTCCCAATTGGAAAAGGCGTCGTGGAAGGATTCAAGGAGACGGCTGGCGTGGAGACGGAT
GACGGCAAGCATCACGACCATGGCATGAGTCACCATGGCAGTCAGCATAATGGCCACGGTGATAAGGAGGGCAAT
GGCGCTCATGACCACGTCAAGCAGGTGCACAAGCACAGCACGATACAGGCAGACATGGACACGGAGCGGCGACAT
GGGCAGCAACGGCCGTACCAAATCACGAGCATCAGCTTCGTGGGACACTCGCTGGGCGGCTTGGTGCAGACTTAT
GCCGTTGCCTACATCCAGAAACACTCGCCGCAGTTTTTCGACGTGATCAAACCAATCAACTTTATAGCCCTGGCC
TCGCCCTTTCTTGGGCTGAGCAACGAGAACCCGCTCTATGTAAAGTTTGCTCTAGACTTTGGCCTGGTGGGCAGG
ACAGGGCAGGACTTGGGTTTGACTTGGCGGGCTCCGACTATTGCTCGCAGCGGATGGGGCGCCCTTGTTGGCAAC
CTGGGCGAGTCGGCGCACAAGAAGGTGTATGGCGAGATGCAGCCCGAGTCGAAGCCGCTGCTGCGCATTCTGCCC
ACGGGCCCGGCCCACGCGGCGCTCAACAAGTTTCGAAACCGCACCGTCTACTCCAACGTGGTGAATGACGGCATC
GTGCCGCTGCGAACCAGCTGTCTGCTCTTCCTCGACTGGCAGGGGCTTGGGCGCGTGGAAAAGGCACGCAGAGAC
GCGGGGCTGGTTGAGACGGTGGTTGGCTTTGGCTGGGCCGAGCTCATGGGCACCAACATGACGAGTCCTCGCAGC
AAGCACCCGCCCTCGGGCGACGGGCGGCGGGCTGACGAAGCAATGCGCGAGGTGCCTCAGCCGCCCAACGAGGCC
ATGGATGAAGACGACGGAGCCAGCATCAAGTCGATGCCCGAAGGATTCTCGGAAGATGCGGCGGCAGCAGCAGCG
GCCCCGGTCAGCGCCAACGAGCCCAACCACTCTGGAGCTCTGTCCACCTTTCTCAATCTCTTCAAGAGCAACGAG
TCTCCCAAGGAGCATGCCAAGGAGCATGCCAAGGAGCATATCAAGGAGCAGGCCAAGGAGCACGCCATGTCACAG
AAGCAAAAAAAGATTTTGCGGCGGGGCCAGACGATGCCGCTCGACCAAGCAGCTGCTGGCAAGCAGCAGACCAAG
GTGACGTCGGGCCACGAGCTCGAGGGCCAGGACCAGGCCATGACGGCTCCCCCCAAGACGACCTTTTTCGAATCG
GCGGGCGATGTGCTGAATCCAAGCATGCCCAGCACCGAATACATTATCGATCCTACCAAGCGGCCACGAAGCATC
TTCCACGACCGCGTCTATCACCCCAGCGACATTCCACCTCCGCCGCTCAAGAAGCGACAGACGAGCAGCCTGAGC
CGGCGTAAGACGTTTCACAAAGGCAACTCGACGGGCAGCACCTCTTCAGGGCCATATAGCACAGGCAAGACGGGC
GAGTCATCATGGGTCAGGGACTATGACGACACGGCGCATACAAAAGCAGACAAGAAAGCAGACGAGGTGGTGGAC
GGCTCGAGCATGCGCGTCGAGGAAAAGATTGCCCGAGGCTACCATCGCGACTTGTCGTGGCGCAAAGTCTTGGTC
AAGCTGGAGCCGGATGCGCACAACAACATTGTAGTGAGACGCATGTTTGCCAATGCCTACGGCTGGCCCGTAATC
AAGCACCTGGTGGACGCGCATTTTAGCGACTTGGCCAGTGCGCGAATGCGTGACGAGGACGAGGACTCGGCTGAA
GGCGCACTCGACATGAACCAGCCACCCGACGAGCACGGCGGTGAGACAAAGGGCCAAGTGGCGTCGCTGCCCTCG
TCGCCCAGCTCGTCAGGCGGCCACGGCAAGCCCGAAAATGCCGCAGCAGCCACCTCGGATGCCGTGACGCGCACC
GTCAGCGAGGCACGCGAGGCCCTCGATCAGGTGGGCCACCTGCCGTCTTGGTCGCTCCAAGATGGCCAAGACGGA
CGAGCATCAAGTAGGGCCGACTCGGTGACTTGGAGCGAGCGCGACTGGAGCGACAGCGGCAACGAGAGCGAGCTG
GACACGGGCGTTGGGGGCAAAGACTTGAGCAAACAAGAACAGCCAAGCCTGAGCCCAAGGCCGTGGAACTGGACG
GAAAAAATTGTAGGCAAGGGCGCGGCGTCGAACCGTAGCAAGAGCCCCAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail