Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1260
Gene name
LocationContig_13:215467..217261
Strand+
Gene length (bp)1794
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01661 Macro Macro domain 2.7E-23 115 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8P0X2|ADPRH_STRP8 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_1168 PE=3 SV=1 98 280 2.0E-37
sp|Q5XC09|ADPRH_STRP6 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0919 PE=3 SV=1 98 280 2.0E-37
sp|P0DC29|ADPRH_STRPQ Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1056 PE=3 SV=1 98 280 3.0E-37
sp|P0DN70|ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM50868 PE=1 SV=1 98 280 3.0E-37
sp|P0DC28|ADPRH_STRP3 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0856 PE=3 SV=1 98 280 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8P0X2|ADPRH_STRP8 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=spyM18_1168 PE=3 SV=1 98 280 2.0E-37
sp|Q5XC09|ADPRH_STRP6 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0919 PE=3 SV=1 98 280 2.0E-37
sp|P0DC29|ADPRH_STRPQ Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=SPs1056 PE=3 SV=1 98 280 3.0E-37
sp|P0DN70|ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM50868 PE=1 SV=1 98 280 3.0E-37
sp|P0DC28|ADPRH_STRP3 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=SpyM3_0856 PE=3 SV=1 98 280 3.0E-37
sp|Q99ZI6|ADPRH_STRP1 Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M1 GN=SPy_1216 PE=3 SV=1 98 280 4.0E-37
sp|Q8NYB7|ADPRH_STAAW Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain MW2) GN=MW0302 PE=3 SV=1 56 281 5.0E-34
sp|Q6GCE6|ADPRH_STAAS Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0302 PE=3 SV=1 56 281 5.0E-34
sp|Q6GJZ1|ADPRH_STAAR Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0322 PE=3 SV=1 56 281 8.0E-34
sp|P67344|ADPRH_STAAN Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain N315) GN=SA0314 PE=3 SV=1 98 281 1.0E-33
sp|P67343|ADPRH_STAAM Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0325 PE=1 SV=1 98 281 1.0E-33
sp|Q5HIW9|ADPRH_STAAC Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain COL) GN=SACOL0396 PE=3 SV=1 56 281 5.0E-33
sp|Q93RG0|ADPRH_TREMD Protein-ADP-ribose hydrolase OS=Treponema medium PE=3 SV=1 36 281 6.0E-33
sp|Q8PHB6|Y3343_XANAC Macro domain-containing protein XAC3343 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=XAC3343 PE=3 SV=2 94 281 6.0E-20
sp|Q8P5Z8|Y3184_XANCP Macro domain-containing protein XCC3184 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC3184 PE=3 SV=1 94 281 2.0E-19
sp|Q9BQ69|MACD1_HUMAN O-acetyl-ADP-ribose deacetylase MACROD1 OS=Homo sapiens GN=MACROD1 PE=1 SV=2 97 280 1.0E-18
sp|B7LT90|YMDB_ESCF3 O-acetyl-ADP-ribose deacetylase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ymdB PE=3 SV=2 95 256 3.0E-18
sp|Q2KHU5|MACD1_BOVIN O-acetyl-ADP-ribose deacetylase MACROD1 OS=Bos taurus GN=MACROD1 PE=2 SV=1 97 280 7.0E-18
sp|E1SDF1|YMDB1_PANVC O-acetyl-ADP-ribose deacetylase 1 OS=Pantoea vagans (strain C9-1) GN=ymdB1 PE=3 SV=1 97 281 1.0E-17
sp|E1PL40|YMDB2_PANVC O-acetyl-ADP-ribose deacetylase 2 OS=Pantoea vagans (strain C9-1) GN=ymdB2 PE=3 SV=1 97 281 2.0E-17
sp|A0A0H3JQ59|SIRTM_STAAM Protein ADP-ribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0326 PE=1 SV=1 307 552 6.0E-17
sp|Q8K4G6|MACD1_RAT O-acetyl-ADP-ribose deacetylase MACROD1 (Fragment) OS=Rattus norvegicus GN=Macrod1 PE=2 SV=2 97 280 8.0E-17
sp|Q8Y3S3|Y2759_LISMO Macro domain-containing protein lmo2759 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2759 PE=3 SV=1 97 265 8.0E-17
sp|Q8KAE4|Y2219_CHLTE Macro domain-containing protein CT2219 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT2219 PE=3 SV=1 102 281 9.0E-17
sp|Q926Y8|Y2902_LISIN Macro domain-containing protein lin2902 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2902 PE=3 SV=1 97 265 1.0E-16
sp|Q9HXU7|Y3693_PSEAE Macro domain-containing protein PA3693 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3693 PE=3 SV=1 98 280 2.0E-16
sp|D2TT52|YMDB_CITRI O-acetyl-ADP-ribose deacetylase OS=Citrobacter rodentium (strain ICC168) GN=ymdB PE=3 SV=2 95 256 3.0E-16
sp|Q922B1|MACD1_MOUSE O-acetyl-ADP-ribose deacetylase MACROD1 OS=Mus musculus GN=Macrod1 PE=1 SV=2 97 280 3.0E-16
sp|D3RKJ0|YMDB_KLEVT O-acetyl-ADP-ribose deacetylase OS=Klebsiella variicola (strain At-22) GN=ymdB PE=3 SV=1 93 271 5.0E-16
sp|B5XXK9|YMDB_KLEP3 O-acetyl-ADP-ribose deacetylase OS=Klebsiella pneumoniae (strain 342) GN=ymdB PE=3 SV=1 93 271 5.0E-16
sp|Q6PAV8|MACD2_XENLA O-acetyl-ADP-ribose deacetylase MACROD2 OS=Xenopus laevis GN=macrod2 PE=2 SV=1 97 286 5.0E-16
sp|Q71W03|Y2748_LISMF Macro domain-containing protein LMOf2365_2748 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_2748 PE=3 SV=1 97 265 9.0E-16
sp|Q8EYT0|Y4133_LEPIN Macro domain-containing protein LA_4133 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=LA_4133 PE=3 SV=1 102 280 1.0E-15
sp|Q72M93|Y3295_LEPIC Macro domain-containing protein LIC_13295 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=LIC_13295 PE=3 SV=1 102 280 2.0E-15
sp|A8AI35|YMDB_CITK8 O-acetyl-ADP-ribose deacetylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ymdB PE=3 SV=1 95 256 3.0E-15
sp|Q3UYG8|MACD2_MOUSE O-acetyl-ADP-ribose deacetylase MACROD2 OS=Mus musculus GN=Macrod2 PE=1 SV=1 91 281 4.0E-15
sp|Q8Q0F9|Y177_METMA Macro domain-containing protein MM_0177 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0177 PE=3 SV=1 95 266 4.0E-15
sp|Q8Y2K1|Y334_RALSO Macro domain-containing protein RSc0334 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc0334 PE=3 SV=1 102 284 4.0E-15
sp|A7MG20|YMDB_CROS8 O-acetyl-ADP-ribose deacetylase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ymdB PE=3 SV=1 93 257 1.0E-14
sp|A4W960|YMDB_ENT38 O-acetyl-ADP-ribose deacetylase OS=Enterobacter sp. (strain 638) GN=ymdB PE=3 SV=1 97 252 1.0E-14
sp|Q8TQD0|Y1614_METAC Macro domain-containing protein MA_1614 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1614 PE=3 SV=1 68 253 1.0E-14
sp|B4T2X8|YMDB_SALNS O-acetyl-ADP-ribose deacetylase OS=Salmonella newport (strain SL254) GN=ymdB PE=3 SV=1 95 256 2.0E-14
sp|B5RBF3|YMDB_SALG2 O-acetyl-ADP-ribose deacetylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ymdB PE=3 SV=1 95 256 3.0E-14
sp|A1Z1Q3|MACD2_HUMAN O-acetyl-ADP-ribose deacetylase MACROD2 OS=Homo sapiens GN=MACROD2 PE=1 SV=1 97 359 3.0E-14
sp|Q985D2|Y7730_RHILO Macro domain-containing protein mll7730 OS=Rhizobium loti (strain MAFF303099) GN=mll7730 PE=3 SV=1 95 286 4.0E-14
sp|C9Y0V8|YMDB_SICTZ O-acetyl-ADP-ribose deacetylase OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=ymdB PE=3 SV=1 93 257 4.0E-14
sp|P67342|YMDB_SALTI O-acetyl-ADP-ribose deacetylase OS=Salmonella typhi GN=ymdB PE=3 SV=1 95 256 4.0E-14
sp|P67341|YMDB_SALTY O-acetyl-ADP-ribose deacetylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ymdB PE=3 SV=1 95 256 4.0E-14
sp|Q88SK6|Y3408_LACPL Macro domain-containing protein lp_3408 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_3408 PE=3 SV=1 98 281 9.0E-14
sp|Q9HJ67|Y1105_THEAC Uncharacterized protein Ta1105 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta1105 PE=3 SV=2 97 267 1.0E-13
sp|B5F961|YMDB_SALA4 O-acetyl-ADP-ribose deacetylase OS=Salmonella agona (strain SL483) GN=ymdB PE=3 SV=1 95 256 1.0E-13
sp|D5CE05|YMDB_ENTCC O-acetyl-ADP-ribose deacetylase OS=Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) GN=ymdB PE=3 SV=1 98 269 1.0E-13
sp|Q44020|YGB2_CUPNE Macro domain-containing protein in gbd 3'region OS=Cupriavidus necator PE=3 SV=1 98 245 2.0E-13
sp|Q0T5Z6|YMDB_SHIF8 O-acetyl-ADP-ribose deacetylase OS=Shigella flexneri serotype 5b (strain 8401) GN=ymdB PE=3 SV=1 95 256 2.0E-13
sp|Q93SX7|Y189_ACISE Macro domain-containing protein OS=Acinetobacter sp. (strain ED45-25) PE=3 SV=1 101 281 2.0E-13
sp|P0A8D6|YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia coli (strain K12) GN=ymdB PE=1 SV=1 95 256 3.0E-13
sp|P0A8D8|YMDB_ECO57 O-acetyl-ADP-ribose deacetylase OS=Escherichia coli O157:H7 GN=ymdB PE=3 SV=1 95 256 3.0E-13
sp|P0A8D7|YMDB_ECOL6 O-acetyl-ADP-ribose deacetylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ymdB PE=3 SV=1 95 256 3.0E-13
sp|P0DN71|SIRTM_STRPG Protein ADP-ribosyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM50869 PE=1 SV=1 307 538 9.0E-13
sp|Q8RB30|Y995_CALS4 Macro domain-containing protein TTE0995 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0995 PE=3 SV=1 110 279 2.0E-12
sp|Q32E73|YMDB_SHIDS O-acetyl-ADP-ribose deacetylase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ymdB PE=3 SV=1 95 256 4.0E-12
sp|Q66HX8|GDAP2_DANRE Ganglioside-induced differentiation-associated protein 2 OS=Danio rerio GN=gdap2 PE=2 SV=1 77 288 8.0E-12
sp|Q8RHQ2|Y1951_FUSNN Uncharacterized protein FN1951 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN1951 PE=3 SV=1 100 277 9.0E-12
sp|Q97AU0|Y719_THEVO Uncharacterized protein TV0719 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV0719 PE=3 SV=1 101 282 2.0E-11
sp|Q9NXN4|GDAP2_HUMAN Ganglioside-induced differentiation-associated protein 2 OS=Homo sapiens GN=GDAP2 PE=1 SV=1 68 304 1.0E-10
sp|Q2KIX2|GDAP2_BOVIN Ganglioside-induced differentiation-associated protein 2 OS=Bos taurus GN=GDAP2 PE=2 SV=1 90 304 1.0E-10
sp|Q87JZ5|Y4103_VIBPA Macro domain-containing protein VPA0103 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0103 PE=3 SV=1 97 245 4.0E-10
sp|Q66H63|GDAP2_RAT Ganglioside-induced differentiation-associated-protein 2 OS=Rattus norvegicus GN=Gdap2 PE=2 SV=1 90 304 6.0E-10
sp|Q9DBL2|GDAP2_MOUSE Ganglioside-induced differentiation-associated protein 2 OS=Mus musculus GN=Gdap2 PE=1 SV=1 89 304 2.0E-09
sp|Q9ZBG3|Y6450_STRCO Macro domain-containing protein SCO6450 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO6450 PE=3 SV=1 101 280 4.0E-09
sp|Q5XGM5|GDAP2_XENLA Ganglioside-induced differentiation-associated protein 2 OS=Xenopus laevis PE=2 SV=1 98 285 6.0E-09
sp|Q9EYI6|Y189_STRNO Macro domain-containing protein in sno 5'region OS=Streptomyces nogalater PE=3 SV=1 101 246 3.0E-08
sp|Q4R678|GDAP2_MACFA Ganglioside-induced differentiation-associated protein 2 OS=Macaca fascicularis GN=GDAP2 PE=2 SV=1 81 304 3.0E-08
sp|Q9KHE2|Y189_STRGR Macro domain-containing protein in non 5'region OS=Streptomyces griseus PE=3 SV=1 101 246 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1260
MANLDEILLHVVREGPATRHQCHDIDRLSGRLARLDNAKRIQLLQQLLCVRQAEPPLPEAILEGIDIELQSRKRQ
RLLTRIDSIPAVGTFSSSIRGSVWSGDITTLSRGVTAITNAANSSGLGCFQPSHRCIDNAIHAWAGPRLRQDCYA
LMRRRACCLEPGDVIVTGGHCLPANHVIHVVGPQLEPDTDPDETECQQLGRCYGTVLEAVEQLAAEADGGKRVVF
CGISTGLFAFPAAKAAEIAIQATAQWFQEHAQSTVTDVIFNTLTAADQDVYQTALSLPRSGWQPCLGPVSRSGPV
IECDSLERARHWLKDADAIVVSAGAGLSAAAGLDYTSTSLFAQRFPGFVKYGLSTLYSVFGFSAWPTEEDRWGYL
FTHLNLVKTWPQSPLYRALIAWLHSFGQEAHVRTSNADGLFVANGWPADKLSTPQGSYSVVQCLNNCRLEATEPS
AAWLEAALPALDGVTQRLTDTSKVPLCRYCGSKMSICVRAADWFNDGPFQDGEECWRRFRERLRSQKKRTVLLEL
GVGLSTPGVLRWPNELLTRAGDGNIKLIRAGMGPEVAVPKDLENKGLATAIDGDMAATIARLCCWQGMEDCA*
Coding >OphauB2|1260
ATGGCGAACCTAGATGAAATATTGCTCCATGTCGTGCGCGAGGGTCCCGCGACTAGGCATCAATGTCATGATATC
GATAGACTCAGCGGCCGTCTGGCTCGACTCGACAATGCAAAGCGGATACAACTGCTCCAGCAGCTGCTTTGCGTG
CGTCAGGCAGAGCCGCCACTACCAGAAGCCATCCTGGAAGGCATAGACATTGAGCTACAAAGCCGAAAACGCCAG
CGGTTGCTCACGCGCATCGATAGCATCCCGGCCGTGGGCACCTTTTCATCCAGCATCCGCGGCTCTGTCTGGAGT
GGCGACATTACAACGCTCAGCCGAGGAGTAACGGCAATCACCAACGCAGCAAACAGCAGCGGGCTGGGATGTTTC
CAACCGTCGCATCGCTGCATCGACAATGCCATCCACGCCTGGGCAGGTCCACGACTGCGGCAAGACTGTTACGCC
TTGATGCGCCGGCGGGCTTGTTGTCTGGAGCCTGGAGACGTCATTGTGACTGGCGGCCACTGCCTACCCGCAAAC
CATGTAATCCATGTCGTCGGCCCCCAGCTGGAGCCTGACACAGACCCTGATGAGACAGAATGCCAGCAGCTTGGG
CGGTGCTATGGCACGGTCCTTGAGGCTGTCGAGCAACTGGCTGCTGAGGCCGATGGCGGCAAGCGAGTAGTCTTT
TGCGGCATCTCAACCGGCCTGTTTGCATTTCCAGCAGCCAAGGCGGCCGAGATTGCCATACAAGCCACAGCCCAA
TGGTTTCAGGAGCATGCGCAGTCAACCGTCACCGACGTCATTTTCAACACCTTGACCGCCGCTGATCAAGACGTG
TACCAGACAGCTCTCTCATTGCCTCGCTCAGGCTGGCAGCCATGTCTCGGACCGGTTTCCCGGTCAGGGCCAGTC
ATAGAGTGTGACTCGCTAGAGCGCGCGCGCCATTGGCTGAAAGATGCTGATGCCATTGTCGTCAGCGCCGGAGCT
GGCCTGTCGGCAGCCGCCGGCCTTGACTATACGTCGACGTCTCTCTTTGCCCAAAGATTCCCGGGTTTCGTCAAG
TACGGTCTGAGCACGCTCTACAGCGTATTTGGCTTCTCAGCCTGGCCGACGGAGGAGGACCGATGGGGCTACTTG
TTCACCCATCTCAATCTCGTCAAGACGTGGCCCCAGTCGCCCTTGTACCGCGCTCTTATCGCGTGGCTTCATTCC
TTCGGGCAAGAGGCCCACGTGCGCACCTCCAACGCTGACGGGCTTTTCGTGGCCAATGGGTGGCCGGCAGACAAA
CTTTCCACTCCGCAGGGCTCCTACTCGGTTGTGCAGTGTCTCAACAATTGCAGGCTTGAGGCAACAGAGCCGTCG
GCGGCGTGGCTCGAGGCAGCGCTGCCTGCTCTTGATGGCGTGACACAGCGCTTGACAGATACGAGCAAGGTGCCG
CTCTGTCGATACTGTGGCAGCAAAATGAGCATCTGTGTCAGAGCAGCCGACTGGTTCAACGACGGCCCATTCCAA
GACGGGGAGGAGTGTTGGAGACGGTTTCGTGAGCGGCTACGCAGTCAGAAGAAACGGACGGTGCTGCTTGAGCTT
GGAGTTGGACTATCGACGCCAGGAGTGCTGCGATGGCCCAACGAGCTGCTGACAAGAGCAGGAGATGGCAACATC
AAGCTTATTAGGGCCGGAATGGGGCCTGAAGTGGCGGTGCCTAAAGACTTGGAAAACAAGGGATTGGCAACAGCC
ATTGACGGCGACATGGCAGCAACTATTGCGCGACTTTGTTGCTGGCAGGGAATGGAGGATTGTGCATAG
Transcript >OphauB2|1260
ATGGCGAACCTAGATGAAATATTGCTCCATGTCGTGCGCGAGGGTCCCGCGACTAGGCATCAATGTCATGATATC
GATAGACTCAGCGGCCGTCTGGCTCGACTCGACAATGCAAAGCGGATACAACTGCTCCAGCAGCTGCTTTGCGTG
CGTCAGGCAGAGCCGCCACTACCAGAAGCCATCCTGGAAGGCATAGACATTGAGCTACAAAGCCGAAAACGCCAG
CGGTTGCTCACGCGCATCGATAGCATCCCGGCCGTGGGCACCTTTTCATCCAGCATCCGCGGCTCTGTCTGGAGT
GGCGACATTACAACGCTCAGCCGAGGAGTAACGGCAATCACCAACGCAGCAAACAGCAGCGGGCTGGGATGTTTC
CAACCGTCGCATCGCTGCATCGACAATGCCATCCACGCCTGGGCAGGTCCACGACTGCGGCAAGACTGTTACGCC
TTGATGCGCCGGCGGGCTTGTTGTCTGGAGCCTGGAGACGTCATTGTGACTGGCGGCCACTGCCTACCCGCAAAC
CATGTAATCCATGTCGTCGGCCCCCAGCTGGAGCCTGACACAGACCCTGATGAGACAGAATGCCAGCAGCTTGGG
CGGTGCTATGGCACGGTCCTTGAGGCTGTCGAGCAACTGGCTGCTGAGGCCGATGGCGGCAAGCGAGTAGTCTTT
TGCGGCATCTCAACCGGCCTGTTTGCATTTCCAGCAGCCAAGGCGGCCGAGATTGCCATACAAGCCACAGCCCAA
TGGTTTCAGGAGCATGCGCAGTCAACCGTCACCGACGTCATTTTCAACACCTTGACCGCCGCTGATCAAGACGTG
TACCAGACAGCTCTCTCATTGCCTCGCTCAGGCTGGCAGCCATGTCTCGGACCGGTTTCCCGGTCAGGGCCAGTC
ATAGAGTGTGACTCGCTAGAGCGCGCGCGCCATTGGCTGAAAGATGCTGATGCCATTGTCGTCAGCGCCGGAGCT
GGCCTGTCGGCAGCCGCCGGCCTTGACTATACGTCGACGTCTCTCTTTGCCCAAAGATTCCCGGGTTTCGTCAAG
TACGGTCTGAGCACGCTCTACAGCGTATTTGGCTTCTCAGCCTGGCCGACGGAGGAGGACCGATGGGGCTACTTG
TTCACCCATCTCAATCTCGTCAAGACGTGGCCCCAGTCGCCCTTGTACCGCGCTCTTATCGCGTGGCTTCATTCC
TTCGGGCAAGAGGCCCACGTGCGCACCTCCAACGCTGACGGGCTTTTCGTGGCCAATGGGTGGCCGGCAGACAAA
CTTTCCACTCCGCAGGGCTCCTACTCGGTTGTGCAGTGTCTCAACAATTGCAGGCTTGAGGCAACAGAGCCGTCG
GCGGCGTGGCTCGAGGCAGCGCTGCCTGCTCTTGATGGCGTGACACAGCGCTTGACAGATACGAGCAAGGTGCCG
CTCTGTCGATACTGTGGCAGCAAAATGAGCATCTGTGTCAGAGCAGCCGACTGGTTCAACGACGGCCCATTCCAA
GACGGGGAGGAGTGTTGGAGACGGTTTCGTGAGCGGCTACGCAGTCAGAAGAAACGGACGGTGCTGCTTGAGCTT
GGAGTTGGACTATCGACGCCAGGAGTGCTGCGATGGCCCAACGAGCTGCTGACAAGAGCAGGAGATGGCAACATC
AAGCTTATTAGGGCCGGAATGGGGCCTGAAGTGGCGGTGCCTAAAGACTTGGAAAACAAGGGATTGGCAACAGCC
ATTGACGGCGACATGGCAGCAACTATTGCGCGACTTTGTTGCTGGCAGGGAATGGAGGATTGTGCATAG
Gene >OphauB2|1260
ATGGCGAACCTAGATGAAATATTGCTCCATGTCGTGCGCGAGGGTCCCGCGACTAGGCATCAATGTCATGATATC
GATAGACTCAGCGGCCGTCTGGCTCGACTCGACAATGCAAAGCGGATACAACTGCTCCAGCAGCTGCTTTGCGTG
CGTCAGGCAGAGCCGCCACTACCAGAAGCCATCCTGGAAGGCATAGACATTGAGCTACAAAGCCGAAAACGCCAG
CGGTTGCTCACGCGCATCGATAGCATCCCGGCCGTGGGCACCTTTTCATCCAGCATCCGCGGCTCTGTCTGGAGT
GGCGACATTACAACGCTCAGCCGAGGAGTAACGGCAATCACCAACGCAGCAAACAGCAGCGGGCTGGGATGTTTC
CAACCGTCGCATCGCTGCATCGACAATGCCATCCACGCCTGGGCAGGTCCACGACTGCGGCAAGACTGTTACGCC
TTGATGCGCCGGCGGGCTTGTTGTCTGGAGCCTGGAGACGTCATTGTGACTGGCGGCCACTGCCTACCCGCAAAC
CATGTAATCCATGTCGTCGGCCCCCAGCTGGAGCCTGACACAGACCCTGATGAGACAGAATGCCAGCAGCTTGGG
CGGTGCTATGGCACGGTCCTTGAGGCTGTCGAGCAACTGGCTGCTGAGGCCGATGGCGGCAAGCGAGTAGTCTTT
TGCGGCATCTCAACCGGCCTGTTTGCATTTCCAGCAGCCAAGGCGGCCGAGATTGCCATACAAGCCACAGCCCAA
TGGTTTCAGGAGCATGCGCAGTCAACCGTCACCGACGTCATTTTCAACACCTTGACCGCCGCTGATCAAGACGTG
TACCAGACAGCTCTCTCATTGCCTCGCTCAGGCTGGCAGCCATGTCTCGGACCGGTTTCCCGGTCAGGGCCAGTC
ATAGAGTGTGACTCGCTAGAGCGCGCGCGCCATTGGCTGAAAGATGCTGATGCCATTGTCGTCAGCGCCGGAGCT
GGCCTGTCGGCAGCCGCCGGCCTTGACTATACGTCGACGTCTCTCTTTGCCCAAAGATTCCCGGGTTTCGTCAAG
TACGGTCTGAGCACGCTCTACAGCGTATTTGGCTTCTCAGCCTGGCCGACGGAGGAGGACCGATGGGGCTACTTG
TTCACCCATCTCAATCTCGTCAAGACGTGGCCCCAGTCGCCCTTGTACCGCGCTCTTATCGCGTGGCTTCATTCC
TTCGGGCAAGAGGCCCACGTGCGCACCTCCAACGCTGACGGGCTTTTCGTGGCCAATGGGTGGCCGGCAGACAAA
CTTTCCACTCCGCAGGGCTCCTACTCGGTTGTGCAGTGTCTCAACAATTGCAGGCTTGAGGCAACAGAGCCGTCG
GCGGCGTGGCTCGAGGCAGCGCTGCCTGCTCTTGATGGCGTGACACAGCGCTTGACAGATACGAGCAAGGTGCCG
CTCTGTCGATACTGTGGCAGCAAAATGAGCATCTGTGTCAGAGCAGCCGACTGGTTCAACGACGGCCCATTCCAA
GACGGGGAGGAGTGTTGGAGACGGTTTCGTGAGCGGCTACGCAGTCAGAAGAAACGGACGGTGCTGCTTGAGCTT
GGAGTTGGACTATCGACGCCAGGAGTGCTGCGATGGCCCAACGAGCTGCTGACAAGAGCAGGAGATGGCAACATC
AAGCTTATTAGGGCCGGAATGGGGCCTGAAGTGGCGGTGCCTAAAGACTTGGAAAACAAGGGATTGGCAACAGCC
ATTGACGGCGACATGGCAGCAACTATTGCGCGACTTTGTTGCTGGCAGGGAATGGAGGATTGTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail