Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1256
Gene name
LocationContig_13:209141..210462
Strand+
Gene length (bp)1321
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17187 Svf1_C Svf1-like C-terminal lipocalin-like domain 6.8E-60 216 377
PF08622 Svf1 Svf1-like N-terminal lipocalin domain 1.6E-54 55 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICI6|SVF1_GIBZE Survival factor 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SVF1 PE=3 SV=1 1 377 0.0E+00
sp|Q7RX39|SVF1_NEUCR Survival factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=svf-1 PE=3 SV=1 1 377 0.0E+00
sp|Q4WVE5|SVF1_ASPFU Survival factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=svf1 PE=3 SV=1 2 377 1.0E-159
sp|Q5BH63|SVF1_EMENI Survival factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=svf1 PE=3 SV=2 2 377 9.0E-149
sp|Q5ABA2|SVF1_CANAL Survival factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SVF1 PE=3 SV=1 1 378 5.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICI6|SVF1_GIBZE Survival factor 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SVF1 PE=3 SV=1 1 377 0.0E+00
sp|Q7RX39|SVF1_NEUCR Survival factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=svf-1 PE=3 SV=1 1 377 0.0E+00
sp|Q4WVE5|SVF1_ASPFU Survival factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=svf1 PE=3 SV=1 2 377 1.0E-159
sp|Q5BH63|SVF1_EMENI Survival factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=svf1 PE=3 SV=2 2 377 9.0E-149
sp|Q5ABA2|SVF1_CANAL Survival factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SVF1 PE=3 SV=1 1 378 5.0E-100
sp|Q6BIH2|SVF1_DEBHA Survival factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SVF1 PE=3 SV=2 1 378 4.0E-98
sp|Q09885|SVF1_SCHPO Survival factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=svf1 PE=3 SV=1 1 377 2.0E-95
sp|Q755L7|SVF1_ASHGO Survival factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SVF1 PE=3 SV=1 1 378 1.0E-88
sp|Q6FY35|SVF1_CANGA Survival factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SVF1 PE=3 SV=1 1 378 2.0E-88
sp|Q6CQY2|SVF1_KLULA Survival factor 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SVF1 PE=3 SV=1 1 357 3.0E-86
sp|Q6CBN5|SVF1_YARLI Survival factor 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SVF1 PE=3 SV=1 1 377 5.0E-84
sp|Q05515|SVF1_YEAST Survival factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SVF1 PE=1 SV=1 1 378 8.0E-77
sp|Q05948|YL225_YEAST Uncharacterized SVF1-like protein YLR225C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR225C PE=1 SV=1 53 377 5.0E-25
sp|Q04925|YDR22_YEAST SVF1-like protein YDR222W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR222W PE=1 SV=1 48 377 1.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0050896 response to stimulus No
GO:0006950 response to stress No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1256
MFNWAKQQLANVAGTQEPIYGPSAIRSVAVEARETPFSELTRQDLEWKALESTCVETASFYLISNSGHVALAQVI
YSNVAGIRMTCQFNTKLYSKDSSKPHLWCSTPLKNVDFSQDKTSFFADDCAVELSADGTSYTIKSMNDERALVNL
KVTRVAPGFQAGRTGTTKFGTNLDKPWGSMRHAFWPRCVAEGTITTKDGPIDFKGQALFVYALQGMKPHHAAARW
NFAYFQGPEYTAVMMEYTTPPSYGSTVVNLGGVAKDGQIVWADCDNKAVHTKCKEDAETAWPEPSHIELSWTGKD
KDGKSAEAVLEGSLGQRTDRVDIMAEVPGFIKKIVAGTAGTKPYIYQFSPKQTLKVKVGGEEIVEEGQLLFEATF
VSE*
Coding >OphauB2|1256
ATGTTCAACTGGGCCAAGCAACAGCTGGCCAACGTGGCCGGCACTCAGGAGCCCATTTACGGCCCATCTGCCATA
CGCTCCGTCGCAGTCGAGGCTCGAGAAACGCCCTTTAGCGAACTCACGAGACAGGACCTCGAATGGAAGGCTCTC
GAGTCAACATGCGTCGAAACGGCAAGCTTCTACCTAATTTCAAATAGCGGCCATGTTGCACTGGCCCAAGTCATT
TATAGTAACGTTGCTGGCATCCGAATGACGTGCCAGTTCAACACCAAGCTCTACTCCAAAGATTCATCCAAGCCC
CATTTATGGTGCTCGACACCCCTCAAAAACGTCGACTTTAGCCAAGATAAAACGTCCTTCTTTGCCGATGACTGT
GCGGTGGAGCTATCAGCCGACGGTACATCGTATACGATCAAGAGCATGAATGATGAGCGGGCCCTGGTCAACCTC
AAGGTGACAAGAGTCGCTCCAGGTTTCCAGGCTGGGCGCACCGGCACCACCAAGTTTGGCACCAATCTTGACAAG
CCCTGGGGCTCCATGAGACACGCTTTTTGGCCTCGCTGCGTCGCTGAAGGCACAATAACAACAAAAGACGGCCCC
ATCGACTTCAAGGGCCAAGCGCTCTTTGTCTACGCTCTGCAGGGTATGAAGCCTCACCATGCCGCGGCACGGTGG
AACTTTGCCTATTTCCAAGGACCAGAGTACACGGCCGTCATGATGGAGTACACAACACCGCCTTCATACGGGTCA
ACTGTTGTCAACCTCGGAGGCGTTGCCAAGGACGGTCAAATCGTCTGGGCAGACTGCGACAACAAGGCTGTTCAC
ACCAAGTGCAAGGAGGATGCAGAAACTGCATGGCCGGAGCCAAGCCACATCGAGCTCTCGTGGACCGGCAAGGAC
AAAGACGGCAAGTCTGCAGAGGCAGTCTTGGAGGGCTCTCTGGGCCAACGAACAGACAGGGTGGACATCATGGCC
GAGGTGCCGGGGTTTATCAAGAAAATAGTGGCGGGCACAGCAGGGACGAAGCCATACATTTACCAGTTTTCACCC
AAGCAAACCCTCAAGGTCAAGGTGGGAGGCGAGGAAATAGTGGAAGAGGGCCAGTTGCTTTTCGAAGCAACATTT
GTCTCGGAATAG
Transcript >OphauB2|1256
ATGTTCAACTGGGCCAAGCAACAGCTGGCCAACGTGGCCGGCACTCAGGAGCCCATTTACGGCCCATCTGCCATA
CGCTCCGTCGCAGTCGAGGCTCGAGAAACGCCCTTTAGCGAACTCACGAGACAGGACCTCGAATGGAAGGCTCTC
GAGTCAACATGCGTCGAAACGGCAAGCTTCTACCTAATTTCAAATAGCGGCCATGTTGCACTGGCCCAAGTCATT
TATAGTAACGTTGCTGGCATCCGAATGACGTGCCAGTTCAACACCAAGCTCTACTCCAAAGATTCATCCAAGCCC
CATTTATGGTGCTCGACACCCCTCAAAAACGTCGACTTTAGCCAAGATAAAACGTCCTTCTTTGCCGATGACTGT
GCGGTGGAGCTATCAGCCGACGGTACATCGTATACGATCAAGAGCATGAATGATGAGCGGGCCCTGGTCAACCTC
AAGGTGACAAGAGTCGCTCCAGGTTTCCAGGCTGGGCGCACCGGCACCACCAAGTTTGGCACCAATCTTGACAAG
CCCTGGGGCTCCATGAGACACGCTTTTTGGCCTCGCTGCGTCGCTGAAGGCACAATAACAACAAAAGACGGCCCC
ATCGACTTCAAGGGCCAAGCGCTCTTTGTCTACGCTCTGCAGGGTATGAAGCCTCACCATGCCGCGGCACGGTGG
AACTTTGCCTATTTCCAAGGACCAGAGTACACGGCCGTCATGATGGAGTACACAACACCGCCTTCATACGGGTCA
ACTGTTGTCAACCTCGGAGGCGTTGCCAAGGACGGTCAAATCGTCTGGGCAGACTGCGACAACAAGGCTGTTCAC
ACCAAGTGCAAGGAGGATGCAGAAACTGCATGGCCGGAGCCAAGCCACATCGAGCTCTCGTGGACCGGCAAGGAC
AAAGACGGCAAGTCTGCAGAGGCAGTCTTGGAGGGCTCTCTGGGCCAACGAACAGACAGGGTGGACATCATGGCC
GAGGTGCCGGGGTTTATCAAGAAAATAGTGGCGGGCACAGCAGGGACGAAGCCATACATTTACCAGTTTTCACCC
AAGCAAACCCTCAAGGTCAAGGTGGGAGGCGAGGAAATAGTGGAAGAGGGCCAGTTGCTTTTCGAAGCAACATTT
GTCTCGGAATAG
Gene >OphauB2|1256
ATGTTCAACTGGGCCAAGCAACAGTGGGCTTCATTTCGGCCAAGAGCCTCCTAACTGCTGGCCAAGATGCGCTGA
CCACTGGACAGGCTGGCCAACGTGGCCGGCACTCAGGAGCCCATTTACGGCCCATCTGCCATACGCTCCGTCGCA
GTCGAGGCTCGAGAAACGCCCTTTAGCGAACTCACGAGACAGGACCTCGAATGGAAGGCTCTCGAGTCAACATGC
GTCGAAACGGCAAGCTTCTACCTAATTTCAAATAGCGGCCATGTTGCACTGGCCCAAGTCATTTATAGTAACGTT
GCGTAAGGCTTGTCATGAGCTCGTCGCGGCCTTGACTTGGCTGACGCGTCTTGCAATGGCAGTGGCATCCGAATG
ACGTGCCAGTTCAACACCAAGCTCTACTCCAAAGATTCATCCAAGCCCCATTTATGGTGCTCGACACCCCTCAAA
AACGTCGACTTTAGCCAAGATAAAACGTCCTTCTTTGCCGATGACTGTGCGGTGGAGCTATCAGCCGACGGTACA
TCGTATACGATCAAGAGCATGAATGATGAGCGGGCCCTGGTCAACCTCAAGGTGACAAGAGTCGCTCCAGGTTTC
CAGGCTGGGCGCACCGGCACCACCAAGTTTGGCACCAATCTTGACAAGCCCTGGGGCTCCATGAGACACGCTTTT
TGGCCTCGCTGCGTCGCTGAAGGCACAATAACAACAAAAGACGGCCCCATCGACTTCAAGGGCCAAGCGCTCTTT
GTCTACGCTCTGCAGGGTATGAAGCCTCACCATGCCGCGGCACGGTGGAACTTTGCCTATTTCCAAGGACCAGAG
TACACGGCCGTCATGATGGAGTACACAACACCGCCTTCATACGGGTCAACTGTTGTCAACCTCGGAGGCGTTGCC
AAGGACGGTCAAATCGTCTGGGCAGACTGCGACAACAAGGCTGTTCACACCAAGTGCAAGGAGGATGCAGAAACT
GCATGGCCGGAGCCAAGCCACATCGAGCTCTCGTGGACCGGCAAGGACAAAGACGGCAAGTCTGCAGAGGCAGTC
TTGGAGGGCTCTCTGGGCCAACGAACAGACAGGGTGGACATCATGGCCGAGGTGCCGGGGTTTATCAAGAAAATA
GTGGCGGGCACAGCAGGGACGAAGCCATACATTTACCAGGTCTGTGCCATGTCATGATTGATGGCTGCTCGATGC
ATACTGACGCGACATGTGGCCTTAGTTTTCACCCAAGCAAACCCTCAAGGTCAAGGTGGGAGGCGAGGAAATAGT
GGAAGAGGGCCAGTTGCTTTTCGAAGCAACATTTGTCTCGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail